KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_909725Help
Entry
ARALYDRAFT_909725 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARALYDRAFT_909725
   00052 Galactose metabolism
    ARALYDRAFT_909725
   00500 Starch and sucrose metabolism
    ARALYDRAFT_909725
   00520 Amino sugar and nucleotide sugar metabolism
    ARALYDRAFT_909725
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ARALYDRAFT_909725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 469 aa AA seqDB search
MAAATEKLPLLKSAVDGLTEMSENEKSGFINLVSRYLSGEAQHIEWSKIQTPTDEIVVPY
DKMANVSQDATETKYLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIEN
LNNKYGCKVPLVLMNSFNTHDDTQKIVEKYTKSNVDIHTFNQSKYPRVVADEFVPWPSKG
KTDKDGWYPPGHGDVFPSLMNSGKLDAFLSQSKEYVFIANSDNLGAIVDLKILKHLIQNK
NEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVN
LKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPVK
ATSDLLLVQSDLYTLVDGFVIRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVELD
SLKVSGDVWFGSGVVLKGKVSVKANSGTKLEIPDNAVLENKDINGPEDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcaacggagaagctccctctgctcaaatccgccgtcgatggactcactgag
atgagtgagaatgagaagagcggattcatcaacctcgtttcacgttacctcagtggtgag
gcccaacacattgaatggagtaagatccagacacctactgatgaaattgttgttccttac
gataaaatggctaacgtctctcaagatgccaccgagaccaaatatctgttggacaagctt
gttgtgctaaagcttaatggaggtttgggaaccacaatgggatgcaccggtcctaaatcg
gttatcgaagttcgtgatggtttgacatttcttgacctgattgttatccagattgagaat
ctcaacaacaagtatggctgcaaggttcccttggttcttatgaactcattcaatacacat
gatgacacacaaaagattgtggaaaaatacaccaagtcaaatgttgatattcacactttt
aatcagagcaagtatcctcgtgttgttgctgatgagtttgtgccgtggccaagcaaagga
aagactgacaaggacggatggtatcctcccggtcacggtgatgtattcccatccctcatg
aacagtggaaagctcgatgcgttcttatcacagagtaaggagtatgtgttcatcgccaac
tcagacaacttgggcgctattgttgacttaaaaatcttgaagcacctgatccagaacaaa
aatgagtactgtatggaggttacacccaaaacactagctgatgtaaagggaggaactctc
atttcttacgaaggaagagtacagcttttggagattgctcaggttcctgatgaacatgtc
aatgaattcaaatcaattgagaaattcaagattttcaacacaaacaacctttgggttaac
ttgaaagctatcaaaaagcttgtggaagctgatgcacttaaaatggagatcatcccaaac
ccgaaggaagttgatggagtcaaagttcttcaactggaaactgcagctggtgctgctata
aggttttttgataatgcaatcggtgtgaatgtacctcggtcacgattcttgccagtgaag
gcaacttcagacttgcttcttgttcaatcggatctgtatacactcgtcgatggttttgtc
ataagaaacaaagctagaacaaaccccacaaacccagcgatcgaattgggacccgaattc
aaaaaggtagcgagcttccttagccggtttaagtccatcccgagtatagttgagctcgat
agccttaaggtttctggtgatgtctggtttggctcaggcgttgttctcaagggcaaagtg
tcagtaaaggcaaactccgggactaaacttgaaatccctgacaatgccgtgctcgagaat
aaggatatcaacggtccagaggatctgtga

DBGET integrated database retrieval system