KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_910046Help
Entry
ARALYDRAFT_910046 CDS       T01578                                 

Definition
phospholipase/carboxylesterase family protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARALYDRAFT_910046
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ARALYDRAFT_910046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 252 aa AA seqDB search
MSISGAAVGSGRNLRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLPN
IKWICPTAPSQPISLFGGFPSTAWFDVVDINEDGPDDMEGLDVAAAHVANLLSNEPADIK
LGVGGFSMGAATSLYSATCFALGKYGNGNPYPINLSTIIGLSGWLPCAKTLAGKLEEEQI
KNRAASLPIIVCHGKADDVVPFKFGEKSSQALLSNGFKKVTFKPYSALGHYTIPQEMDEL
CAWLTSTLGLEG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctccggtgctgcagttggttcaggcagaaatttaagaagagcggtagagttt
gggaaaactcatgtggttaggcctaaagggaaacatcaagcaactattgtctggctacat
gggcttggggacaatggctcgagctggtcccagcttttggagacccttccccttccaaat
atcaaatggatatgcccgactgctccttctcagccaataagtttgtttggtggttttccc
tccacagcttggtttgatgttgtggacatcaatgaagatggacctgatgatatggaagga
ttggatgtggctgctgcacatgttgcaaatctgttgtcgaatgagcctgctgacattaaa
ttaggtgttggagggttcagcatgggtgcggcgacatctctgtattctgcaacttgtttt
gctctcggtaaatatggaaatggcaatccgtaccctatcaatttaagcacaatcataggc
ttaagcggttggcttccttgtgcaaagacattggctggcaaactagaagaggaacagatc
aagaaccgagctgcatcattgcccattatagtctgtcatggaaaagctgatgatgtggta
ccgttcaagtttggggagaaatcttcccaagccttgctttcaaatgggtttaagaaggtg
acctttaaaccttacagtgcacttggtcactacacaatcccacaggagatggatgagttg
tgcgcttggttgacatccaccctcggcctggaaggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system