KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_910823Help
Entry
ARALYDRAFT_910823 CDS       T01578                                 

Definition
CYCH_1
Orthology
K06634  
cyclin H
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ARALYDRAFT_910823
  Replication and repair
   03420 Nucleotide excision repair
    ARALYDRAFT_910823
Transcription machinery [BR:aly03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ARALYDRAFT_910823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MADFQTSTQRAKWIFTPQKLADKYKAANKRAVQMLEKCGTTQVEVDASGSLTYPKDKVDA
ADPADKKLKPLSVDEERFMRAFYEAKVQEVCSAFAFPHKIQATALQYFKRFYLQWSVMQH
HPKEIMLTCVYAACKIEENHVSAEEIGKGINQDHQIILKYEMAVLQSLEFDLIVYAPYRA
IEGFVNNMEEFLQARDDQIQKLESLLKAATAEADKVMLTDAPLLFPPGQLALASLRIANG
VLGVIDFDRYLENIVSQPNSEHTTSELTKFLDDIEFLVKNYKKPSEKDMKHINRKLKSCL
GHSSSHDESKKREKRSKHKSHRSSNDTPNGAPIG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcggattttcagacatcaacacaacgggccaagtggattttcactccccagaaactg
gcagacaaatataaagctgctaacaagagggcagtgcaaatgctggagaagtgtggaaca
acccaagttgaagtagatgccagtggatcactaacatatcctaaagataaagttgatgca
gcagatccagctgataagaagcttaagcctttgagtgttgatgaagaacggttcatgaga
gcattttatgaggctaaggtccaagaagtgtgtagtgcctttgcatttcctcacaagatt
caggcaacagccctccaatactttaagagattttatctgcaatggtctgttatgcaacat
catccaaaagagataatgttaacctgtgtgtatgcagcttgtaaaatagaggagaatcat
gtatctgctgaggaaattgggaaagggattaaccaagatcaccagatcattctcaagtat
gagatggctgttcttcagagtttggaatttgatctgattgtttatgcaccgtatcgtgca
attgaaggttttgtcaacaatatggaggaatttcttcaagctagagatgatcaaatccag
aaactggagagtttactcaaagcggcgacagcagaagccgataaagttatgctcacagat
gctccactcctctttcctcctggccagttggcattggcgtctttacgtattgcaaatggg
gttcttggagtgattgactttgataggtacctagagaacattgtttctcaaccaaactct
gagcacacaacttcagagctcacaaagttccttgatgacatcgaatttttggtaaagaac
tacaagaaaccaagtgaaaaggacatgaagcatatcaaccggaagctaaaatcttgtcta
ggacatagttcttcacatgacgagagtaagaaacgggagaagagatcgaagcacaagtcc
cataggagctccaatgatacaccaaacggggcaccgataggttga

DBGET integrated database retrieval system