KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_911244Help
Entry
ARALYDRAFT_911244 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARALYDRAFT_911244
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     ARALYDRAFT_911244
    2.7.1.82  ethanolamine kinase
     ARALYDRAFT_911244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 342 aa AA seqDB search
MAIGIFGLIPSSSPDELRKILQALSTKWGDVVEDFESLEVKPMKGAMTNEVFMVSWPRKE
TNLRCRKLLVRVYGEGVELFFNRDDEIRTFEYVARHGHGPTLLGRFAGGRVEEFIHARTL
SATDLRDPNVSALVASKLKRFHSIHIPGDRNVLIWDRMRTWIGQAKNLCSNEHSAEFGLD
DIEDEINMLEQEVNNEQEIGFCHNDLQYGNIMIDEDTNAITIIDYEYASYNPIAYDIANH
FCEMAADYHSNTPHILDYTLYPGEEERRRFICNYLTSSGEEDIEQFLDDIEKYTLASHLF
WGLWGIISGYVNKIEFDYIEYSRQRFKQYWIRKPQVLSFYPS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcaataggaatctttggattgatcccaagctcatcaccagacgagctaaggaagatt
cttcaagcactttcgacgaaatggggagacgtggtcgaggattttgagagtcttgaagtg
aaaccaatgaaaggagcgatgactaacgaagttttcatggttagttggccaagaaaagaa
acaaatcttcgatgtaggaaacttcttgttcgtgtttatggagaaggtgttgagcttttc
ttcaatagagacgatgagattcgtacttttgagtatgtagctcgtcatggccatggacct
actctccttggacgcttcgccggcggtagagtcgaagagtttatccatgctcggacacta
tcggcaaccgatcttcgtgatccgaacgtatcagctctggttgcatctaagctaaaaaga
tttcacagcatacacattcctggagatagaaatgtgctcatatgggacaggatgaggact
tggataggacaagccaagaatctgtgttcaaatgaacattcagcagagtttggtctagac
gacattgaagatgaaatcaacatgctggaacaagaagtgaacaatgaacaagagattggc
ttctgtcacaatgatttgcagtatggtaacatcatgattgatgaagacaccaatgccatt
actatcattgattatgagtatgcaagttataatccaatcgcttacgacatagcaaatcat
ttctgtgaaatggcggcagattatcattctaacactcctcatatcttggactacactcta
tatccaggagaagaagaaaggaggagattcatctgtaactacctcacttcttcaggtgaa
gaagatatagaacagttcttggatgatattgagaagtatacattggcaagccatctcttc
tggggtttatggggaatcatctctggttatgtgaacaagattgagttcgattatatcgag
tattcgaggcagagattcaaacagtattggattcgaaagccacaagttttatctttctac
ccatcctaa

DBGET integrated database retrieval system