KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_911953Help
Entry
ARALYDRAFT_911953 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00260  Glycine, serine and threonine metabolism
aly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_911953
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARALYDRAFT_911953
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARALYDRAFT_911953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB NMO NanE Ribul_P_3_epim TMP-TENI IGPS FMN_dh BtpA CbiX
Motif
Other DBs
NCBI-GeneID: 9308898
NCBI-ProteinID: XP_002874906
UniProt: D7M3G0
Position
Unknown
AA seq 276 aa AA seqDB search
MEDLLKNPPATVGLSETFAKLKSQGKVALIPYITAGDPDLSTTAKALKVLDSCGSDIIEL
GVPYSDPLADGPAIQAAARRSLLKGTNFNSIITMLKEVIPQLSCPIALFTYYNPILRRGI
DNYMTVIKNAGVHGLLVPDVPLEETEALRNEARKHQIELVLLTTPTTPKERMNAIVEASE
GFIYLVSSVGVTGTRESVNEKVQSLLQQIKEATSKPVAVGFGISKPEHVKQVAEWGADGV
IVGSAMVKILGESESPEQGLEELEVFTKSLKFALIS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcttctcaagaatcctcccgccacggttggtctatcagaaactttcgctaag
ttaaaatcacaaggcaaagtggctctgattccatatatcactgctggtgatcctgatctt
tctactacagcaaaagctcttaaagtgcttgattcgtgtggttccgacataatcgaactc
ggtgttccatactctgatccattagctgatggtcctgcaatccaggctgctgcgagacgt
tcgttacttaaaggaaccaactttaactccattatcactatgctcaaagaggttattcct
cagttatcttgtccaattgcattgtttacgtattacaatccgatcctgcggcgaggaatt
gacaactatatgactgttattaagaatgctggagtccatggccttcttgttcctgatgtt
ccactcgaggaaactgaggctctgcggaacgaagctcgaaagcatcagattgaactcgta
ctgctcacaacacccacaaccccgaaagaacgaatgaacgccattgttgaagcatctgaa
ggattcatctatctcgtaagttcagtaggggttactggtacaagagagtctgttaacgaa
aaagttcaatctcttttacaacaaatcaaagaggcaacaagcaagccagtagccgttgga
tttggcatatcaaaacctgagcatgtgaaacaggtagctgaatggggagcagatggagtc
attgttggtagcgcgatggttaagatcttgggcgagtctgaatcacctgagcaaggactt
gaggagctagaagtcttcactaaatctttaaaatttgctcttatctcttga

DBGET integrated database retrieval system