KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_911989Help
Entry
ARALYDRAFT_911989 CDS       T01578                                 

Definition
pectinesterase family protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aly00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aly00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 453 aa AA seqDB search
MTSLSSNLSHRDRCAFDDCLELLDDTVFDLTTAVSELRSHSPELHNVKMFLSAAMTNTRT
CLDGFASSNNDENNNNKTYGVAESLKESLFNISSHVSDSLAMLEEIPGNIPGKLEEDVGF
PMWVSGSDRNLLQDPVDETKVNLVVAQNGTSNYTTIGEAVSAAPNSSETRFVIYIKCGEY
FENIEIPREKTMIMFIGDGIGRTVIKANRSYADGWTAFHSATVGVRGSGFIAKDLSFVNY
AGLASHQAVALRSSSDLSAFYRCSFESFQDTLYVHSHKQFYRECDIYGTVDFIFGDASVV
FQNCSLYARRPNPNQKIIYTAQGRENSSQPTGISIISSKILAAPDLIPVQANFKAYLGRP
WQLYSRTVIMKSFIGDLVDPAGWLKWKDDFALETLYYGEYMNEGPGSNMTNRVQWPGFKR
IETAEEATQFSVGPFIEGNKWLNSTGIPFTIDL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgctgagctctaacctaagccatcgcgatcgctgcgcattcgatgactgcctc
gagctactcgatgacaccgtctttgatctcaccaccgcagtatctgagcttcggtctcat
tctccggagctccataacgtcaaaatgtttctcagcgccgcgatgacgaatacaagaaca
tgtctcgatggttttgcttctagcaacaacgacgagaataataataataagacgtatgga
gtggctgagagcttgaaagagagtcttttcaatatctctagccacgtcagcgactcgtta
gctatgcttgaggaaattccagggaatattccggggaaactagaggaggacgttgggttt
ccgatgtgggtctcagggagtgaccggaacctacttcaagatccggtggatgagactaag
gttaatctcgtggtggctcaaaatggtaccagcaactacacaaccatcggcgaggccgta
tctgccgctcctaactcgagtgaaaccaggtttgtgatatatataaaatgtggggaatat
tttgaaaacattgaaataccgagggaaaagacaatgataatgtttattggggatggaatc
ggacggacagtaataaaagctaaccgcagctatgcagatggatggacagcatttcactct
gcgaccgttggcgtgagaggtagtggcttcatagctaaggacttgtcgttcgtgaattat
gccggactggctagtcaccaggctgtggcattacgaagcagctctgacctctctgctttc
taccgatgcagctttgaaagcttccaagacactctttatgtccattcacacaaacagttt
tatcgagagtgtgatatatatggcacggtcgatttcatatttggtgatgcatcggttgtg
ttccagaattgtagtctctatgctcgtagaccaaatcctaaccaaaaaatcatatatacc
gctcaaggccgggaaaactcaagtcaacccacgggtatttctataatcagtagcaagatt
ttggccgcaccagacttgatccctgtgcaagccaactttaaagcatatttaggtcgtccg
tggcaactatattctaggacggttatcatgaaatcgtttattggcgatctggtggatcct
gccggatggttgaagtggaaagatgattttgcccttgaaactttatattatggagagtac
atgaatgaaggtcccgggtcgaacatgacaaacagggtccaatggcctggttttaagcgt
atcgaaaccgcagaggaagcaactcaattctctgttggtccatttatcgaaggtaacaaa
tggcttaactctaccggaattccttttactattgatctctga

DBGET integrated database retrieval system