KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_912028Help
Entry
ARALYDRAFT_912028 CDS       T01578                                 

Definition
swinger
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ARALYDRAFT_912028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 846 aa AA seqDB search
MVTDDSDSSGRIKSHVDDDEEDRLEGLENRLSELKRKIQGERVRSIKEKFEANRKKVDVH
VSPFSSAASSRATAGDNGNSNVFSSRMEIPLCKLNGFSHGVGDRDYVPTKDVTAASVKLP
IAERIPPYTTWIFLDRNQRMAEDQSVVGRRQIYYERHGGETLICSDSEEEPEPEEEKREY
SEGEDSVIWLIGQEYGMGEEVQDSLCQFLSVDASDILGRYNELKLKDEQNTENFSNSGFK
LGISLEKDLGAALDSFDNLFCRRCLVFDCRLHGCSQPLISASEKQSYWSDYEGDRKPCSK
HCYLQVEVKAVREVPKAEEKASKEECSKAISSDDPHDAATGVNLQVEKTDIGFKNLDSSS
GVEQEHGIRGKREVPNLEDSNDLPNLSNKKQKTTASDTKMSLVNSTPSLDQAFDSSKGDQ
SETVETNNVNRDSGADSKEVAEPLPDILVLDGGSSVCQPDHGSGNGSIIIGEMSEKSQPS
TEWNPIEKDLYLKGVEIFGRNSCLIARNLLSGLKTCLDVSSYMRENEVSVFRRSSTPNLL
LDDGRTDPGNDDDEVPPRTRLFRRKGKTRKLKYSTKSAGHPSVWKRIAGGKNQSCKQYTP
CGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRECDP
DVCRNCWVSCGDGSLGEAPRRGEGQCGNMRLLLRQQQRILLGKSDVAGWGAFLKNSVSKN
EYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKGDKLKFANHSAKPNC
YAKVMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKKDDSAITHRRA
RKHQSH
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggtgacagatgatagcgactcctctggaagaatcaagtctcatgtagatgatgatgaa
gaagataggctcgagggtttggagaacagattaagtgagcttaaaaggaaaattcaagga
gaaagagttaggtctattaaagagaaatttgaggctaatagaaagaaagtggatgttcat
gtttctcccttttcatctgctgcatcgagccgggctaccgcaggggataatggaaatagc
aatgttttttcttcgagaatggaaataccactctgcaaattaaatggtttttctcatggg
gtgggagatagagactatgttcctactaaggatgttacagcagcaagtgtcaagcttccg
attgctgagagaataccgccttacactacctggatatttctggacagaaatcaaagaatg
gcggaagatcagtctgtggttggtcgaagacaaatttactatgagagacatggtggtgag
acactgatatgcagcgatagtgaggaagaaccagaacctgaggaggaaaaacgtgaatat
tccgagggtgaagactctgttatatggttgattgggcaggagtatggcatgggtgaggaa
gtgcaggattctctttgccagtttctcagcgtagatgcttcagacattctgggaagatac
aatgaactcaagttgaaggatgagcagaatactgagaacttttctaattccggattcaag
cttggaatatctctggaaaaggaccttggtgcagctctagattcttttgataatcttttc
tgccgccgttgcttggtatttgactgtcgtctgcatggatgttctcagcctttaattagt
gctagtgaaaaacagtcttattggtctgattatgaaggtgataggaagccctgcagcaaa
cattgttacctccaggttgaggtcaaggcggtcagagaagtacctaaagcagaagagaaa
gcttcaaaagaggaatgcagcaaggctatctcctcagatgaccctcatgatgctgctact
ggtgtcaatctgcaagttgagaagactgatattggtttcaagaatttagattcatcctct
ggtgtagaacaagagcatggaattaggggaaagcgtgaggtcccgaatctcgaagactcc
aatgatctgcctaatttatcaaacaagaaacagaagaccacagcctcagatacaaaaatg
tcacttgttaattctacccctagcttagatcaggcatttgatagctcaaagggtgatcaa
agtgaaacagttgagaccaacaatgtaaacagagactcaggagctgattcaaaagaagta
gctgaacctcttccagacattttggtccttgatggtggttcctccgtttgtcagccagac
catggtagtggaaatggatcaataatcattggagaaatgtctgagaaaagtcaaccatct
acagagtggaaccctatcgagaaggatctttacttaaagggagtcgaaatctttgggaga
aacagctgtcttattgcaagaaacctactttctggcttgaagacatgcctagatgtgtcc
agttacatgcgtgaaaacgaagtttcagtttttcgaagatctagcaccccaaatttgctg
ttggatgatggcaggactgacccagggaatgatgatgatgaggtgcctccaaggacaaga
ttgttccgtagaaaaggtaaaactcgaaagctaaaatactctacaaagtctgctggtcat
ccatctgtctggaaaagaatagccggtggcaaaaaccagtcctgtaaacaatacacacca
tgtggatgcctgtcaatgtgcggaaaggattgcccttgtctaaccaatgaaacttgttgc
gagaaatattgcgggtgctcaaaaagctgcaaaaatcgcttccgaggatgtcattgtgca
aagagtcaatgcagaagtaggcagtgtccctgctttgctgctggcagagaatgtgatcca
gatgtttgcagaaattgctgggttagttgtggagatggttctctcggcgaagcaccaaga
cgcggagaagggcaatgcggaaacatgagacttctcctgaggcaacaacagaggatacta
ttgggaaagtctgatgttgctggatggggtgcttttctaaagaactcggtcagcaaaaat
gagtatctcggagaatacactggcgaattgatctcacaccgcgaggcggataagcgtggg
aaaatatatgaccgggcaaattcgtccttcctttttgacttgaatgatcagtacgtcctc
gatgctcaacgcaaaggagacaagctgaaatttgccaatcactcggcaaaacccaattgc
tatgctaaggtgatgtttgtagcaggagatcacagggtcggcatttttgcaaacgaacga
atagaagctagcgaggagcttttctatgactatagatatggaccagaccaagcaccagct
tgggctcgcaaacctgaaggctcgaagaaagatgattcagccattactcatcgtagagcc
agaaagcatcaatctcattaa

DBGET integrated database retrieval system