KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_912062Help
Entry
ARALYDRAFT_912062 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00860  Porphyrin and chlorophyll metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Module
aly_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_912062
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ARALYDRAFT_912062
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     ARALYDRAFT_912062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 Palm_thioest
Motif
Other DBs
NCBI-GeneID: 9308948
NCBI-ProteinID: XP_002874964
UniProt: D7M498
Position
Unknown
AA seq 539 aa AA seqDB search
MELSLLRPTTQSLLPSFSKPNLRLNVYKPLKLRCSVAGGPIVGSSKISGGGGTTVTADCV
IVGGGISGLCIAQALATKHPNATPNLIVTEAKDRVGGNIITREENGFLWEEGPNSFQPSD
PMLTMVVDSGLKDDLVLGDPTAPRFVLWDGKLRPVPSKLTDLPFFDLMSIGGKIRAGFGA
LGIRPSPPGREESVEEFVRRNLGDEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWKLEQ
NGGSIIGGTFKAIQERKNAPKAERDPRLPKPKGQTVGSFRKGLRMLPEAISARLGSKVKL
SWKLSGITKLDSGGYNLTYETPDGVVSVQSKSVVMTVPSHVASGLLRPLSESAANALSKL
YYPPVAAVSVSYPEEAIRTECLIDGELKGFGQLHPRTQGVETLGTIYSSSLFPNRAPPGR
ILLLNYIGGSTNTGILSKSEGELVEAVDRDLRKMLIKPNSADPLKLGVRVWPQAIPQFLV
GHFDILDTAKSSLTSSGYEGLFLGGNYVAGVALGRCVEGAYETATEVNNFMSRYAYKSM
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggagttatctcttctccgtccgacgactcaatcgcttcttccgtcgttctcgaaaccg
aatctccgattaaatgtctataagcctcttaagctccgttgttcggtggccggtggacca
atcgtcggatcttccaaaattagcggcggaggaggcaccaccgtcacggcggattgtgtg
attgtcggcggaggtatcagtggtctttgcatcgcgcaggcgcttgctacgaagcatcct
aacgctacaccgaatttgattgtgactgaggctaaggatcgtgttggaggcaacattatc
actcgtgaagagaatggttttctctgggaagaaggtcctaatagttttcagccgtctgat
cctatgctcactatggtggtagatagtggtttgaaggatgatttggtattgggagatcct
actgcgccaaggtttgtgttgtgggatgggaaattgaggccggttccatcgaagctaaca
gacttaccgttcttcgatttgatgagcattggtgggaagattagagctgggtttggtgca
cttggcattcgaccatcacctccaggtcgtgaagaatccgtggaggagtttgtacggcgt
aaccttggtgatgaggtttttgagcgcctgattgaaccgttttgttcaggtgtttatgcg
ggtgatccttcgaaactgagtatgaaagcagcgtttgggaaggtttggaaactagagcaa
aatggtggaagcatcataggtggtacttttaaggctattcaggagaggaaaaacgctccc
aaggcagagcgagacccgcgcctgccaaaaccaaagggccaaacagttggttctttcagg
aagggacttcgaatgttgccagaagcaatatcagcaaggttaggtagcaaagttaagttg
tcttggaagctctcaggtatcactaagctggacagcggaggatacaacttaacctatgag
actccagatggtgtagtttccgtgcagagcaaaagtgttgtaatgactgtgccatctcat
gttgcaagcggtctcttgcgccctctttctgaatctgcagcaaatgcactctcaaaacta
tattatccaccagttgcagcagtctctgtctcgtacccggaagaagcaatccgaacagaa
tgtttaatagatggtgaactaaagggtttcgggcaattgcatccacgcacgcaaggagtt
gaaacattaggaactatatacagctcctcgctctttccaaatcgagcaccgcccggaaga
attttgctgttgaactacattggcgggtctacaaacaccgggattctgtccaagtccgaa
ggtgagttagtggaagcagttgacagggatttgaggaaaatgctaattaagcctaattcg
gctgatccacttaaattaggagttagggtatggcctcaagccattcctcagtttctagtt
ggtcactttgatatccttgacacggctaaatcatctctaacgtcttcgggctacgaaggg
ctatttttgggtggcaattacgttgctggtgtagccttaggccggtgtgtagaaggcgca
tatgaaaccgcgactgaggtcaacaacttcatgtcacggtacgcttacaagtcaatgtaa

DBGET integrated database retrieval system