KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_912096Help
Entry
ARALYDRAFT_912096 CDS       T01578                                 

Definition
mitogen-activated protein kinase 4
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ARALYDRAFT_912096
Protein kinases [BR:aly01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   ARALYDRAFT_912096
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ARALYDRAFT_912096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 375 aa AA seqDB search
MSAETCFGSSGDQSSKGLPTHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAAT
NSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVY
IVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANC
DLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTRE
PLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAG
AVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKE
LIYRETVKFNPQDSV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggaaacttgtttcggaagttcaggtgatcaaagcagcaaaggattgcctact
catggtggtagctatgttcagtataatgtctatggcaatctcttcgaagtttctagaaag
tatgttcctcctcttcgtcccatcggtagaggcgcttatggtattgtctgtgctgctaca
aactcagagactggagaggaagtagctatcaagaagatcggtaatgcttttgacaatatt
atcgatgctaaaagaactttgagagagattaagcttctcaagcatatggatcatgaaaat
gtgattgctgtcaaggatataataaaaccaccgcagagagagaacttcaatgatgtttac
attgtttatgagcttatggacactgatctccaccaaattatacgctctaaccaaccgttg
actgatgatcattgtcggttttttctgtatcagttgttgcgagggctcaaatacgttcat
tcagctaatgtattgcaccgagatttgaaacccagcaatttgctcctgaatgcaaattgt
gatctaaagcttggggacttcgggcttgcgaggaccaaatccgagacagacttcatgact
gaatatgttgttacacgttggtatcgagccccagagctgctccttaattgctcagaatac
acagcagcaatcgatatttggtctgtcggttgtatactcggtgaaacaatgacacgagag
ccgttgtttcccggtaaagattatgttcatcagcttagactcatcactgagcttatagga
tcgcctgatgactcaagcttgggattcttaagaagtgacaatgcaagaagatacgttaga
cagcttccgcagtacccgagacagaactttgctgctagattcccaaacatgtcggctggt
gcagtcgatttgctggagaaaatgcttgtttttgatccaagcagacgcatcacagttgat
gaggcgttatgccacccatatttggcaccgctgcatgatataaacgaagaaccggtatgt
gtgaggccgttcaatttcgatttcgagcaacctactttgacagaagagaacattaaggag
cttatataccgtgaaacagtcaagttcaatcctcaagactcagtgtga

DBGET integrated database retrieval system