KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_912096Help
Entry
ARALYDRAFT_912096 CDS       T01578                                 

Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 375 aa AA seqDB search
MSAETCFGSSGDQSSKGLPTHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAAT
NSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVY
IVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANC
DLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTRE
PLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAG
AVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKE
LIYRETVKFNPQDSV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggaaacttgtttcggaagttcaggtgatcaaagcagcaaaggattgcctact
catggtggtagctatgttcagtataatgtctatggcaatctcttcgaagtttctagaaag
tatgttcctcctcttcgtcccatcggtagaggcgcttatggtattgtctgtgctgctaca
aactcagagactggagaggaagtagctatcaagaagatcggtaatgcttttgacaatatt
atcgatgctaaaagaactttgagagagattaagcttctcaagcatatggatcatgaaaat
gtgattgctgtcaaggatataataaaaccaccgcagagagagaacttcaatgatgtttac
attgtttatgagcttatggacactgatctccaccaaattatacgctctaaccaaccgttg
actgatgatcattgtcggttttttctgtatcagttgttgcgagggctcaaatacgttcat
tcagctaatgtattgcaccgagatttgaaacccagcaatttgctcctgaatgcaaattgt
gatctaaagcttggggacttcgggcttgcgaggaccaaatccgagacagacttcatgact
gaatatgttgttacacgttggtatcgagccccagagctgctccttaattgctcagaatac
acagcagcaatcgatatttggtctgtcggttgtatactcggtgaaacaatgacacgagag
ccgttgtttcccggtaaagattatgttcatcagcttagactcatcactgagcttatagga
tcgcctgatgactcaagcttgggattcttaagaagtgacaatgcaagaagatacgttaga
cagcttccgcagtacccgagacagaactttgctgctagattcccaaacatgtcggctggt
gcagtcgatttgctggagaaaatgcttgtttttgatccaagcagacgcatcacagttgat
gaggcgttatgccacccatatttggcaccgctgcatgatataaacgaagaaccggtatgt
gtgaggccgttcaatttcgatttcgagcaacctactttgacagaagagaacattaaggag
cttatataccgtgaaacagtcaagttcaatcctcaagactcagtgtga

DBGET integrated database retrieval system