KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_913488Help
Entry
ARALYDRAFT_913488 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ARALYDRAFT_913488
Enzymes [BR:aly01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ARALYDRAFT_913488
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ARALYDRAFT_913488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 546 aa AA seqDB search
MARLLSQTLIHTGRFLLRRFSEPPPAVIAIHRYYSSKSLSLMSPLGLHCSSLSSPPALCN
SAFSSSATSTTVEVQSTEHEVVIALGSNIGNRMNNFREALRLMKRGGICVTRHSCLYETA
PAHVTDQPRFLNAAVRGVTKLGPHELLSVLKTIEKDMGRKDGIRYGPRPLDLDILFYGKM
RISSDKLIIPHERLWERSFVLAPLVDLLGSAVDNDTVAHWHSLAIHPGGIFQAWERLGGE
SLIGQDGIQRVLPIGDKLWDFSNKTHVMGILNLTPDSFSDGGQFQSIDSAVSRVRSMISD
GADIIDIGAQSTRPMASRISSQEELDRLLPVLDAVRGMPEMEEKLISVDTFNSEVASEAI
SNGADILNDVSAGTLDPNMHEVVAESGVPYMAMHMRGDPCTMQNKENLQYDDICKDVASE
LYLRVRDAELSGIPAWRVMIDPGIGFSKSVDHNLDIIMDLPKIREEMAKRSIAVSHAPIL
IGPSRKRFLGDICGRPEATDRDAATVASVTAGILGGANIIRVHDVRHNADAAKLCDAMLR
RRRSKG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtttgctgtcacaaaccttaatccacaccggaagattccttctccgtcgcttc
tcagaaccacctccggcggtaatcgcgatccaccgatactattcgtcgaagtctctttct
ctgatgtctccacttggcttgcactgttcctctttatccagtcctccagcattatgtaac
tcagctttctcatcttcggcaacaagtacaactgttgaagttcaatctacggagcatgaa
gttgtgattgctttaggaagtaacattggaaaccggatgaataatttcagagaagctttg
cgattgatgaagcgtggtggcatttgtgtaaccaggcacagttgtttgtacgaaacggct
cccgctcatgtgactgaccaacccaggtttctcaatgctgcagtgagaggtgttactaag
cttggacctcatgaactattgagtgttctcaagactattgagaaagacatgggacgtaaa
gatggtatacggtatggaccaagaccgcttgatttggacatattgttctacgggaagatg
agaataagttctgataagctgatcataccacatgagagactatgggaaaggtcatttgtg
ttagcacctttggttgatttgctgggatcagctgttgataatgatacagttgctcattgg
cattcgctcgcgatacatcctggtggaatttttcaagcgtgggagagactgggtggcgaa
tcattgattggacaagatggtatacaaagggttttaccaataggagataagctgtgggat
ttttctaacaaaactcatgtaatgggtatacttaatcttactcccgacagctttagtgat
ggagggcaatttcaatcaatagactctgcagtttctcgggttcgctcaatgatctctgat
ggtgcagatataattgatattggagcacagtccacacgcccaatggcctcaagaatttct
agtcaagaagagttggatagactactaccagttttagacgctgttcgaggtatgccagag
atggaggaaaagctcatatccgtggacactttcaactctgaggttgcttcagaagcaata
agcaatggagctgacattctaaatgatgtatctgcgggaaccttagacccgaatatgcat
gaggttgttgcagaatctggggttccttacatggccatgcacatgagaggagatccatgt
acaatgcagaacaaagagaatttgcagtacgatgatatctgcaaggatgttgcttctgaa
ctctacttgagagtgagagatgcggaactctctgggattccagcttggagggttatgatc
gatccagggattgggttttccaagagtgtagatcataatctagatattattatggatctg
ccaaaaatccgagaagagatggctaagagaagtatagcagtatctcatgcgcctatactc
ataggaccttcaaggaagagatttctgggagatatttgtgggcgtcctgaggccactgac
agagatgctgcaactgttgcttctgttactgcaggcattttaggaggtgccaatatcatt
agagttcatgatgttagacataacgcagacgcagcaaaattatgcgatgcaatgctgaga
agaagaaggtcaaaaggatga

DBGET integrated database retrieval system