KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_913573Help
Entry
ARALYDRAFT_913573 CDS       T01578                                 

Definition
PFN2/PRF2/PRO2
Orthology
K05759  
profilin
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Exosome [BR:aly04147]
 Exosomal proteins
  Proteins found in most exosomes
   ARALYDRAFT_913573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 131 aa AA seqDB search
MSWQSYVDDHLMCEVEGNHLKHAAILGQDGSVWAQSSHFPQLKPAEIEGINKDFEEAGHL
APTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGIYDEPMTGGQCNLVVE
RLGDYLIESGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaatcgtacgtcgatgaccatctcatgtgcgaggtcgaaggtaaccacctc
aaacacgccgccatcttaggccaagacggcagtgtctgggctcagagctctcatttccct
cagttgaagcctgcagagatagaaggaatcaacaaagactttgaagaagccggacatctt
gccccaaccgggctttttcttggcggtgaaaagtacatggttgtccaaggtgaggctgga
gccgtcatccgagggaaaaaggggcctggtggagtcactatcaagaagactactcaagct
ctagtctttggcatctatgatgaacccatgactggagggcaatgcaacttggtcgtcgag
aggcttggtgattaccttatcgagtctggtctctaa

DBGET integrated database retrieval system