KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_914113Help
Entry
ARALYDRAFT_914113 CDS       T01578                                 

Gene name
AFC2
Definition
fus3-complementing gene 1
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ARALYDRAFT_914113 (AFC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 427 aa AA seqDB search
MEMERVHEFPHTNMDRRPRKRARLGWDVLPQATKAQVGMFCGQEIGNLSSFPSSGAPSDN
SSSLCVKGVARNGSPPWREDDKDGHYMFELGDDLTPRYKIYSKMGEGTFGQVLECWDRER
KEMVAVKIVRGVKKYREAAMIEIEMLQQLGKHDKGGNRCVQIRNWFDYRNHICIVFEKLG
SSLYDFLRKNNYRSFPIDLVREIGWQLLECVAFMHDLRMIHTDLKPENILLVSSDYVKIP
EYKGSRLQRDVCYKRVPKSSAIKVIDFGSTTYERQDQTYIVSTRHYRAPEVILGLGWSYP
CDVWSIGCIIVELCTGEALFQTHENLEHLAMMERVLGPFPQQMLKKVDRHAEKYVRRGRL
DWPDGATSRDSLKAVLKLPRLQNLIMQHVDHSAGELINMLQGLLRFDPAERLTAREALRH
PFFARRR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagcgtgtgcatgaatttcctcatactaacatggatcgccgtcccagaaag
agagcgcgtctcggctgggatgtgttgcctcaggcaaccaaggctcaggtaggaatgttt
tgtgggcaagagattggaaatttatcaagctttccatcgtccggagctccttcagacaat
agtagctctctttgtgttaagggtgtggctcgtaatggttctcccccatggcgagaagat
gataaggatggacattacatgtttgaactgggagatgacttaactccacgctataaaatc
tatagcaaaatgggcgaaggtacttttggtcaagtgctagaatgttgggatagggagagg
aaggaaatggtggcagtaaaaattgttcgtggtgtgaagaaataccgcgaggccgctatg
attgaaattgaaatgctgcaacagcttggtaaacatgacaaaggtggcaatcgttgtgta
caaattcggaactggtttgactatcgtaaccatatctgtattgtctttgagaagcttgga
tcaagtttatacgattttcttcggaaaaacaattatcggtcctttcccattgatcttgtt
cgtgagattggctggcaactcttggaatgtgtagcatttatgcatgacttgcgcatgatt
catacggaccttaaaccagaaaatattctgttagtctcctcggactatgtgaagattcct
gagtacaagggctcccgattacaaagggatgtttgctataaaagagtgcctaaatcaagt
gcaataaaggtgattgattttggtagcacaacttatgagcgccaggaccaaacctacatt
gtatcaaccagacattatagggctccagaagtcattttaggtcttggctggagttatccg
tgtgatgtttggagcattggatgtatcatagtggagctgtgcacgggtgaagcattgttc
caaacacatgaaaacctggagcatcttgcgatgatggagcgtgttcttgggccgtttcct
caacaaatgctgaagaaagtggaccggcatgcagagaaatatgtgagaagaggtcgtttg
gattggccggatggggcaacctcaagagatagcctgaaagcagttttgaagctccctagg
cttcagaatctaataatgcaacatgtggaccactcggcgggggagttaataaatatgttg
caaggacttctgcggtttgatccggcagagagactaaccgctcgtgaagccctgaggcat
ccttttttcgcaaggagaagatag

DBGET integrated database retrieval system