KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_914224Help
Entry
ARALYDRAFT_914224 CDS       T01578                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_914224
Enzymes [BR:aly01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ARALYDRAFT_914224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 306 aa AA seqDB search
MEPSSGVGPEKRPTVDLVKDKNGTDQILLQNPKGASVKISLHGGQVLSWKTEKGDELLFT
STKANLKPPHPVRGGIPICFPQFGTRGSLEQHGFARNKIWLVENNPPALPSFDPTGKAFV
DLVLKSSDEDTMRIWPYSFEFHLRVSLALDGNLTLISRVRNINSKPFSFSIAYHTYFSIS
DISEVRLEGLETLDYLDNLHDRERFTEQGDALTFESEIDRVYLNSKDVVAVFDHERKRTF
LIRKEGLPDVVVWNPWEKKARALTDLGDDEYKHMLCVDGAAIEKPITLKPGEEWTGKLNL
SLVLST
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatcatctggagtcggtcctgaaaagagaccaaccgttgacttggtcaaggat
aaaaatggaaccgatcagattcttcttcagaatcctaaaggcgcttctgtcaagattagt
ttacatggaggacaagttctttcttggaagactgagaagggtgatgaattgttattcacc
agcaccaaggccaacttgaagcctccccatccggtacgaggaggaatccctatatgcttt
cctcagtttggaactcggggatcacttgagcaacacggttttgcaagaaacaagatatgg
cttgtggaaaacaatccacccgctttaccttcatttgaccctaccggcaaagcctttgtc
gatttggtacttaagtcatctgatgaagacacgatgaggatctggccttacagctttgag
tttcatcttagagtctcattggcgttagatggaaacctaacactgatatcacgagtcaga
aacatcaattcaaagccttttagcttttccattgcttaccacacttacttctccatttcc
gatattagtgaagttagacttgaagggctggaaactcttgactatcttgataacttgcac
gatagagagcggttcacggagcaaggcgatgcattaacctttgaatccgagatcgataga
gtgtacctaaattctaaagacgtggttgctgttttcgaccatgaaagaaaacgcacattc
ctcatcaggaaagaaggtctacctgatgtcgtggtatggaatccatgggagaagaaagcg
agagcattgacggatttgggagatgatgagtataaacacatgttgtgtgttgatggagca
gccattgagaaacctatcactttgaaaccgggtgaagaatggaccggtaaattaaacctt
tcgcttgttctttccacctga

DBGET integrated database retrieval system