KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_914962Help
Entry
ARALYDRAFT_914962 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 235 aa AA seqDB search
MTTVDEGYSAKKWLPLEANPDVINQYLWGLGLSPDEVECNDVFGLDDELLEMVPKPVLAV
LFLYPITKKCEEERIKQDKEIKEKVHQTDKVYFMKQTVDNACGTIGLLHAIGNITSEIKL
SEGSFLDRFFKSTANMTPIERARFLENDSQIEDAHSVAVIAGDTTASDEVDTHFICLACV
DGELYELDGDRAGPISHGVSSPATLLQDAAKVIKTIIEKNPDSLNFNVIAISKKA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagtagacgaaggttattcagctaagaaatggcttccacttgaagctaaccca
gatgttatcaatcagtatctttggggacttggtctttctcctgatgaagtagagtgcaat
gatgtgtttggcttagacgatgaacttctcgagatggttccaaagcctgttcttgctgtt
ctctttctttacccaatcaccaaaaagtgtgaagaagagagaatcaagcaagacaaagaa
attaaggaaaaggtacatcagactgacaaagtctacttcatgaaacaaactgtggataat
gcttgtggaaccattgggctccttcatgctattgggaatataacctctgagatcaaactc
tccgagggatcgttcttggatagattcttcaaatccactgccaatatgactcctatagag
cgtgcaaggtttcttgagaatgacagtcaaatagaagatgctcattctgtagctgttata
gctggtgatacaacggcttcagacgaggtggacacgcatttcatctgtttagcttgtgta
gatggtgagctctatgaacttgatggagatagggcaggaccaatttcacatggtgtttcc
tctccagctactttgttgcaggacgcagcaaaagtgataaagacgataatcgagaagaat
ccggattctctcaacttcaatgtgatagccatctctaagaaagcctga

DBGET integrated database retrieval system