KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_915377Help
Entry
ARALYDRAFT_915377 CDS       T01578                                 

Definition
ATARD2
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:aly00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 199 aa AA seqDB search
MGEVVKDGREDVIQAWYMDDSEEDQRLPHHKDPKEFLSLDKLAELGVLSWRLDADNYETD
EELKKIRESRGYSYMDFCEVCPEKLPNYEEKVKSFFEEHLHTDEEIRYCVAGSGYFDVRD
RNEAWIRVWVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYVDNFVKVNGGGAIDASA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagtggttaaggatggaagagaagatgtgatccaggcttggtatatggatgac
agcgaagaggatcagagacttcctcaccacaaggatcctaaggagtttctatctttggat
aaacttgcagagctgggagtacttagctggagacttgatgctgataactacgaaaccgat
gaggaattgaaaaagatccgcgaatctcgtggttactcctacatggacttttgtgaggta
tgcccggaaaagcttccaaactatgaagagaaagtaaagagctttttcgaagaacatttg
cacactgatgaagagatccgttactgcgttgcaggaagcggttactttgatgtgagggat
cgcaatgaagcttggattagagtatgggtaaagaagggaggtatgatagtcttacctgct
ggaatatatcatcgcttcaccgtggactcagacaactatatcaaggcaatgcggcttttc
gtgggtgaaccggtgtggacaccatacaatcgcccacacgaccatctccctgcaaggaaa
gagtacgtcgataatttcgtcaaggtgaatgggggcggtgccatagacgcgtcagcgtag

DBGET integrated database retrieval system