KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_916754Help
Entry
ARALYDRAFT_916754 CDS       T01578                                 

Gene name
UBP21
Definition
(RefSeq) ubiquitin-specific protease 21
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARALYDRAFT_916754 (UBP21)
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARALYDRAFT_916754 (UBP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 724 aa AA seqDB search
MAEFSDPPPSNLSSSPKLAKPNQTLDESTPTAPIRDLVTHSLSLSSPIRQIQPSSPANAD
ESSSSPSDKTLTTPPAQISPVSNNNFLQITSTSDSYLYRPPRRYIENSDGQSDDDDLNKI
EPTKPLQLSWWYPRIEPTGVGAGLYNSGNTCFIASVLQCFTHTVPLIESLRSYMYQNPCN
CGNEKFCVMQALRDHIELALRSSGHGINIDRFRDNLTHFSSDFMINHQEDAHEFLQSFLD
KLERCCLDPKNEPGSILSQDMNIVDNVFGGGLMSTLCCCNCNSVSNTFEPSLGWSLEIED
VDNLWSALESFTRVEKLEDQLTCDNCKEKVTKEKQLKFDQLPPVATFHLKRFKNDGVTME
KIFEHVEFPLELDLLPFMSSNQNPEVSTKYHLYAFVEHIGIGATFGHYSTYVRSAPETWH
NFDDSKVTRISEDRVLSRPAYILFYAREGTRWFSSTFEQLKAVFEATPLHFSPNSVLENS
YDSVGNSNKDCNDSGGVSIPDGKWSDFCCHEPKEEVFHSAESNNSEDSSAMIDALESPEA
DESEKPFVETSQQREPESCPAGNKANIDESEKPFAETSQQKEPEPSPAADRASIDAPHVP
LLKVQNQDISPKRKAGERATLGGPKRKVQKTNSHPKRQGSFQIQRAHLKTKNQEETRRTK
RAAYRSNVADSAPDPKYIIHAYSYLNRVQTPRARMLANALAGSPTKKRKISTGPRHMKRS
TIKL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatttagtgacccaccaccttcaaatctctcttcttctcctaaattagctaaa
cccaaccaaaccctagatgagtccacaccaaccgctccaattcgagaccttgttactcac
tcgctctctctttcgtcaccgattcgccagattcaaccttcttctccggcgaacgcagat
gagtcttcctcttctccgtcagataaaaccctaactacaccaccagctcagatttcgcct
gttagcaacaacaattttctccaaatcacgagtacgtcagattcgtatctttatcgtcca
ccaaggagatacatagagaatagtgacggtcaaagcgacgacgatgaccttaataagatc
gagccaacaaaaccacttcagctctcatggtggtatccgagaattgaacccaccggtgtt
ggtgctggattgtataattcaggcaacacttgtttcatagcttctgtgttgcaatgcttc
actcacactgtgcctcttattgagagtcttcgttcatacatgtaccaaaacccttgcaac
tgtggcaatgagaagttctgtgttatgcaagctcttcgagatcatatcgagcttgctctg
aggtcttcaggacatggaataaacattgatagatttcgtgataacctgactcatttttca
tctgattttatgataaaccaccaagaagatgcacacgagtttctacagtcgtttttagat
aagctagagagatgttgtttagatcctaagaatgagcctggctctatcttatctcaagat
atgaacattgttgacaatgtctttggtggcggtctcatgagtacgctttgttgctgcaat
tgcaattctgtttccaacacatttgaaccttctcttggatggagtctggaaattgaagat
gttgataacctctggagtgctctagaatcctttacacgtgtcgaaaaacttgaggaccag
ttaacatgtgataactgtaaggagaaagtcacaaaggagaagcaacttaagttcgatcag
ttgccgccggttgctacattccatcttaagagattcaagaatgatggagttactatggag
aagatcttcgagcatgttgagttccctttggagctggatttgctccctttcatgagcagt
aaccaaaatcctgaggtttccacaaaatatcatctttacgcctttgtggagcatattggg
attggagcaacttttggtcattactccacttatgtgagatcagctcctgagacatggcat
aattttgatgactccaaggtcaccagaatcagcgaagacagagttctatcccgtcctgcg
tatatattattttatgcaagagaaggaactcgttggttttccagtacttttgaacagttg
aaggcagtgtttgaagctactccgttacatttttcaccaaactcagtgcttgaaaacagt
tatgatagtgttggtaattctaacaaagactgcaacgactcggggggagtgtcgatccct
gatggaaagtggtcagatttttgctgtcatgagccaaaagaagaagtgttccattcagcc
gagtctaacaacagtgaagattcttcagccatgattgatgctctcgagtcacctgaggct
gatgaatctgagaaaccttttgttgaaacctctcaacagagagaacctgagtcatgtcca
gctggaaacaaagctaacattgatgaatctgagaagccatttgctgagacctctcaacag
aaagaacctgagccaagtccagctgctgacagagctagcattgatgcccctcatgtccct
ctgctcaaggttcagaatcaagacatatctccaaaacgcaaagctggtgagagagctacg
cttggtggaccgaagcgcaaggttcaaaaaacaaattcccatccgaaacgccaaggaagc
tttcagattcaacgtgcgcatttgaaaactaagaaccaagaggaaactcgtagaacaaag
cgggcggcctatagaagcaatgttgctgattctgctccagatcctaagtacataattcat
gcttattcatatctcaacagggtccagacacctcgcgctcgaatgcttgctaatgctttg
gctggttctccgaccaagaaaaggaaaatctcaacagggcccagacacatgaaaagatca
actattaaactttga

DBGET integrated database retrieval system