KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_918741Help
Entry
ARALYDRAFT_918741 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Protein phosphatases and associated proteins [BR:aly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     ARALYDRAFT_918741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 226 aa AA seqDB search
MSQCVDGFKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSA
VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPI
DDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIENIIDKTFEEADTKHD
GKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtgcgttgacggtttcaagcatttatgcacctcggttttagggtgttttgat
cttgatttgtataaacaatccggtggtcttggagatcctgaattgcttgcaagagacact
gtttttagtgtgagtgaaatagaagctctttatgagctgtttaagaaaatcagcagtgcc
gtgattgatgatgggcttataaacaaggaagagtttcagttggctttgtttaagacgaat
aaaaaagagagcttgtttgcagatcgggttttcgatttgtttgatacaaaacacaatgga
atactcgggtttgaggagtttgcccgtgctctctccgtatttcacccaaatgcgcctata
gatgacaaaatccacttttcatttcagctatatgatcttaaacagcaagggttcatcgaa
cggcaagaggtgaaacaaatggttgtcgctacgcttgctgaatctggaatgaatttgaag
gatactgtcatagagaacataatcgataagacgtttgaggaagcagacacaaaacacgat
ggaaagatcgataaggaagagtggagaagccttgttcttagacatcccagccttctgaag
aacatgactcttcagtatctcaaggatatcacgactacgtttccaagctttgtgttccat
tctcaggttgaagatacctga

DBGET integrated database retrieval system