KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_918819Help
Entry
ARALYDRAFT_918819 CDS       T01578                                 

Definition
(RefSeq) profilin-5
  KO
K05759  
profilin
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Membrane trafficking [BR:aly04131]
 Others
  Actin-binding proteins
   Others
    ARALYDRAFT_918819
Cytoskeleton proteins [BR:aly04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     ARALYDRAFT_918819
Exosome [BR:aly04147]
 Exosomal proteins
  Proteins found in most exosomes
   ARALYDRAFT_918819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 131 aa AA seqDB search
MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSSNFPQLKPEEIQGIKDDFTTPGTL
APTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYEEPMAPGQCNMVVE
RLGDYLIESGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacttacgtcgacgatcacttgatgtgcgacgttgaaggaaatcgcctc
accgccgccgcaattctcggccaagacggtagcgtctgggctcagagcagcaatttccct
cagttgaagcctgaggaaattcagggcatcaaagacgattttactacacctggaacactt
gccccaacaggattgttccttggtggcaacaagtacatggtaatccaaggagaaccaaat
gccgtcattcgaggaaagaagggagctggtggtgttaccatcaagaagaccacccaagct
ttggtctttggtatttatgaagaaccaatggctcctggacaatgcaatatggtcgtggag
aggctcggtgactacctgattgaatcggggctctga

DBGET integrated database retrieval system