KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_918905Help
Entry
ARALYDRAFT_918905 CDS       T01578                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aly00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 312 aa AA seqDB search
MATERHHFELAKGINGLDKIVLRESRGRSAEVYLYGSHVTSWKNENGEELLHLSSKAIFK
PPKPIRGGIPLCFPQFSNFGTLESHGFARNRIWEVEANPPPLPLNSCSSAFVDLILRPTE
EDLKIWPHNFEFRLRVALGTEGELTLTSRIRNTNSDGKPFTFTFAYHTYFSVSDINEVRV
EGLETLDYLDNLKNRERFTEQGDAITFESEVDKIYLSTPTKIAILDHEKKRTFVIRKDGL
ADAVVWNPWDKKSKTISDLGDEDYKQMLCVEAAAIERPITLKPGEEWKGRLELSAVPSSY
SSGQLDPKKVLE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagcgtcatcattttgagctcgctaaaggcatcaatggccttgataagatc
gtccttcgcgagtctcgcggccgctctgccgaggtatacttgtatggaagtcatgtgact
tcttggaagaatgagaatggagaagagttacttcacctcagtagcaaggccatattcaag
cccccgaaaccaatacgtggagggattcccctatgctttccacaattcagtaactttggt
acacttgaatcacatggctttgctagaaataggatctgggaggttgaggctaacccacct
ccgttgccattaaattcttgttctagtgcttttgttgacctgatcctaaggccaactgaa
gaagatctgaaaatctggcctcacaattttgagttcaggctgagggtagccttggggacc
gaaggagaattaactctgacatctcgtatcaggaacacgaattctgatggaaagccattt
acattcacatttgcttatcatacctatttctctgtctcagacatcaatgaagtacgggtt
gaaggattggaaacgttggattatcttgacaacttaaagaacagagaacgttttaccgaa
cagggcgacgcaataacttttgaatctgaagttgacaagatttatctaagcacgcctaca
aagattgctattttggaccatgagaaaaagaggactttcgttattcgcaaggacgggctt
gctgatgctgtggtgtggaatccttgggataagaaatcaaagacgatctctgacttggga
gatgaagactataagcaaatgctatgtgtggaagctgcggctatagagagaccgatcaca
ttgaaacctggtgaagaatggaaaggaagactcgaactctctgcggttccttctagttac
tccagtggacagcttgaccccaagaaagtccttgagtga

DBGET integrated database retrieval system