KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_918943Help
Entry
ARALYDRAFT_918943 CDS       T01578                                 

Definition
xylose isomerase family protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARALYDRAFT_918943
   00051 Fructose and mannose metabolism
    ARALYDRAFT_918943
Enzymes [BR:aly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     ARALYDRAFT_918943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 477 aa AA seqDB search
MKKVDFFMLLLCLIAASFLVSADPPTCPADLGGKCSDSDDWQGDFFPEIPKIKYEGPSSK
NPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFGAATKYWPWEDGTNSVSMA
KRRMRANFEFLKKLGVDWWCFHDRDIAPDGTTLEESNKNLDEVIELAKELQKGSKIRPLW
GTAQLFLHPRYMHGGATSSEVGVYAYAAAQVKKAMEVTHYLGGENYVFWGGREGYQTLLN
TDMGRELDHLARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGL
IDEFKLNIECNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEAT
MVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSL
NELVRKRYATWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttgatttttttatgctccttctctgcttaatcgcagcgtcattcctagtg
tctgctgatccaccaacgtgtcctgctgatttgggagggaagtgtagtgattctgatgat
tggcaaggtgatttcttccctgaaatccccaagattaagtatgagggaccttcgagtaag
aacccacttgcttacaggtggtataacgcagaagaggagattcttgggaagaaaatgaag
gattggtttagattcagtgttgcgttttggcatactttccgtgggactggaggtgatcca
tttggtgctgctacaaagtattggccttgggaagatggtactaactctgtgtctatggct
aagagaagaatgagagctaactttgagttcttgaagaaacttggagttgattggtggtgt
ttccatgacagagacatagcacctgatggtactacacttgaggaatctaacaaaaacttg
gatgaagttatcgaactagccaaagaactgcaaaagggaagcaaaatcagaccattgtgg
ggaacagctcagcttttcttgcatcctcgttacatgcacggaggagcaaccagctctgag
gttggagtgtatgcttatgctgctgctcaggtgaagaaagccatggaggttacacattac
ttaggcggtgaaaactacgttttctggggtggtcgtgaaggttatcagacgctcttgaac
actgatatgggaagagagcttgatcatctggccaggttctttgaagctgctgttgcttac
aagaagaagattggattcaaaggcacacttttaatcgagcccaagcctcaagaacccacc
aagcaccagtatgactgggatgctgcaacagctgccaatttcttgaggaaatatggtctt
attgatgagtttaagctcaacattgagtgtaaccacgccacgctttctggtcacacgtgt
catcacgagcttgaaactgcaagacttaatggtttacttggcaacatcgatgcaaacact
ggcgatgctcaaactggatgggataccgatcagtttcttacagatgttggagaagcaacc
atggttatgatgagtgtcatcaaaaatggtgggattgctccaggaggcttcaacttcgac
gccaaactgcgaagagagagtacagatgttgaagacttgttcattgctcatattagtgga
atggatacaatggctcgtggactgagaaatgcagtcaaaatcttggaggagggaagtcta
aacgaattggtacgcaagcgatatgcaacttgggactctgagcttgggaagcaaatagaa
gaaggaaaagccgatttcgagtatcttgagaagaaggctaaagagtttggagaaccaaag
gtttcttctgcaaaacaggagctcgctgagatgatcttccaatcagcaatgtaa

DBGET integrated database retrieval system