KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_919553Help
Entry
ARALYDRAFT_919553 CDS       T01578                                 

Definition
1-deoxy-D-xylulose-5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:aly00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 476 aa AA seqDB search
MMTLNSLSPAESKAFSFLDTSRFNPIPQISGGFSLRRRNQGRDFGKGVKCSVKVEQQQPP
PAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLL
ADQVRRFKPALVAVRNESLINELKEALADLDYKPEIIPGEQGVIEVARHPEAVTVVTGIV
GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQG
LPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEV
IEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVPC
SEVTWPRLDLCKLGSLTFKKPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDE
KISYLDIFKVVELTCDKHRNELITSPSLEEIVHYDLWAREYAANVQLSSGARPVHA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatgacattaaactcactatctccagctgaatccaaagctttttctttcttggatacc
tccaggttcaatccaatccctcaaatctcaggtgggtttagtttgaggaggaggaatcaa
gggagagattttggaaaaggtgtcaagtgttcagtgaaagtggagcagcagcaacctcct
ccagcatggcctgggagagctgttcctgaggcgcctcgtcaatcttgggatggacctaaa
cccatctctatcgttggatctactggttctattggcactcagacattggatattgtggct
gagaatcctgacaaatttagagttgtggctctagctgctggttcgaatgttactctactt
gctgatcaggtaaggagatttaagcctgcgttggttgctgttagaaacgagtcattgatc
aatgagcttaaagaggctttagcggatctggactataaacccgagataattccaggggag
caaggagtgattgaggttgcccgacaccctgaagctgtaactgttgttaccggaatagta
ggttgtgcgggacttaagcctacggttgctgcaattgaagcaggaaaagacattgctctt
gcaaacaaagagacattaatcgcaggtggtcctttcgtgcttccgcttgccaacaaacat
aatgttaagattcttccggcagattcagaacattctgccatatttcagtgtattcaaggt
ttgcctgaaggtgctctacgcaagataatcttgactgcatctggtggagcttttagggat
tggcctgttgaaaagctcaaggaagttaaggtagcggatgcgttgaagcatccaaactgg
aacatgggaaagaaaatcactgtggactcagctacgcttttcaataagggtcttgaggtc
atcgaagctcattatttatttggagctgagtatgacgatatagagattgtcattcatcct
caaagtatcatacactccatgatcgaaacacaggattcatctgtgcttgctcaattgggt
tggcctgatatgcgtttaccgatcctctacaccatgtcatggcccgatagagttccttgt
tctgaagtaacttggccaagactagacctttgcaaactcggttcattgactttcaagaaa
ccagacaatgtgaaatacccatccatggatcttgcttatgctgctggacgagctggaggc
acaatgactggagttctcagcgccgccaatgagaaagccgttgaaatgttcattgatgaa
aagataagctatttagatatcttcaaggttgtggaattaacatgcgataaacatcgaaac
gagttgataacatcaccgtctcttgaagagattgttcactatgacttgtgggcgcgtgaa
tatgccgcgaatgtgcagctttcttctggtgcgaggccagtccatgcctga

DBGET integrated database retrieval system