KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_920141Help
Entry
ARALYDRAFT_920141 CDS       T01578                                 

Gene name
CHY1
Definition
beta-hydroxyisobutyryl-CoA hydrolase 1
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_920141 (CHY1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ARALYDRAFT_920141 (CHY1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ARALYDRAFT_920141 (CHY1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARALYDRAFT_920141 (CHY1)
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     ARALYDRAFT_920141 (CHY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 381 aa AA seqDB search
MAVEMASQSQVLVEEKSSVRILTLNRPKQLNALSFQMISRLLQLFLAFEEDSSVKLVILK
GNGRAFCAGGDVAAVVRDIEQGNWRLGANFFSDEYMLNYVMATYSKAQVSILNGIVMGGG
AGVSVHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEM
LACGLATHFVPSTRLTALEADLCRVGSNDPTFASTILNAYTQHPRLKPQSAYHRLDVIDR
CFSRRTVEEIISALEREATQEADGWISATIQALKKASPASLKISLRSIREGRLQGVGQCL
IREYRMVCHVMKGEISKDFVEGCRAILVDKDKNPKWEPRRLEDMKDSMVEQYFERVEEEE
EWEDLKLPPRNNLPALAIAKL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgagatggcctctcagtctcaggttttggtggaagagaaatcgagtgtcaga
atcttgacactaaatagaccaaagcagctgaatgctctgtccttccaaatgatctctcga
ttgctgcaactgttccttgcatttgaggaggactctagtgtgaaacttgtcatcctaaag
ggtaatggaagagccttttgtgctggtggcgatgttgcagctgttgttcgtgacatcgaa
caaggtaactggagactcggtgccaatttcttctccgatgaatacatgctcaactatgtt
atggccacatatagcaaagctcaggtttcaattttgaatggtatcgtcatgggaggcgga
gctggtgtctccgtccatggtcgatttcgtattgcaactgagaacacggtttttgccatg
cctgagacagctctggggctctttccagatgtaggcgcctcctacttcttgtcaaggctc
cctggattttttggagagtatgttggcctcacaggagctagattagatggcgctgaaatg
cttgcttgtggccttgcaactcattttgtgccttcaacgaggttgactgcattagaagca
gatctttgccgagttggttcaaatgatccaacctttgcctcaacaattctcaacgcatac
acccagcatccgcgcctgaaaccgcagagtgcttaccacaggttagatgttattgatagg
tgcttctcaaggagaacagttgaagaaattatatctgcacttgagagagaggccactcaa
gaagcagatggttggatctcagctaccattcaagcattgaagaaggcttcaccagcaagc
cttaaaatctctcttagatcgataagggaagggcgactgcagggggtggggcagtgtctt
atccgtgagtatagaatggtgtgtcatgtgatgaagggagaaatcagcaaagattttgtg
gaggggtgcagagccatattggtagacaaagataagaacccaaagtgggagccaaggcga
ctggaggacatgaaggatagcatggtagagcagtacttcgagagagtggaggaagaagag
gaatgggaggatctaaagcttccgccaagaaacaacttgcctgctttagcgatcgcaaag
ctgtga

DBGET integrated database retrieval system