KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_920949Help
Entry
ARALYDRAFT_920949 CDS       T01578                                 

Definition
ATGPX2
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ARALYDRAFT_920949
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ARALYDRAFT_920949
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ARALYDRAFT_920949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 169 aa AA seqDB search
MADESPKSIYDFTVKDIGGNDVSLNQYKGKTLLIVNVASKCGLTDANYKELNVLYEKYKE
QGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEK
GGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTLLGQASS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaatctccaaagtctatctacgacttcaccgtcaaggatatcggaggtaac
gatgtgagtttgaaccaatacaaaggcaaaactcttctgattgtcaatgttgcttccaaa
tgtggtctgactgatgccaactacaaggaactgaatgttctgtacgagaaatacaaggag
caagggttggagatattagcattcccttgtaaccagttcttaggacaagaaccaggtaac
aatgaagagattcaacaaactgtctgcaccaggttcaaagctgaattccccatctttgac
aaggtggatgtgaacgggaaaaacacggcgccattatacaaatacttgaaagcagagaaa
ggaggtttgctcattgatgccatcaaatggaatttcaccaaattcttggtttctcctgat
ggcaaagtcttacagagatattctcccagaacctctcctcttcaattcgagaaggacatt
caaactctgttgggacaggcttcttcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system