KEGG   Anaplasma marginale St. Maries: AM1192Help
Entry
AM1192            CDS       T00216                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00010  Glycolysis / Gluconeogenesis
ama00020  Citrate cycle (TCA cycle)
ama00620  Pyruvate metabolism
ama01100  Metabolic pathways
ama01110  Biosynthesis of secondary metabolites
ama01120  Microbial metabolism in diverse environments
ama01130  Biosynthesis of antibiotics
ama01200  Carbon metabolism
Module
ama_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ama00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1192 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AM1192 (pdhC)
   00620 Pyruvate metabolism
    AM1192 (pdhC)
Enzymes [BR:ama01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AM1192 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N DUF5327
Motif
Other DBs
NCBI-ProteinID: AAV87018
Position
1065049..1066350
Genome map
AA seq 433 aa AA seqDB search
MPVRVLMPALSPTMKSGIVARWHKKEGDSVKPGDVIADIETDKAVMEFEYVDEPGVLYKI
LTQEGTRDVPVNQVIAVVRVGDEDVASVEALCNVAHDADAKGSAADSQGTAAVAAPASPS
VVTNTEKPSQPQPERQRPERGVAYPIPDFAEERKIKATPLAKKLASRLSVDITKVAGTGP
YGRVVKADVLDAAAGGGFPSTTGAAGGDVVEVSSMRRVIADRLLESKLTVPHFYLAVDCM
VGELLKLRVEINDSCADRGTKITVNDFVLKAVALAMREFPEINSSWEGDRIRYHRDINIS
FAVSIDGGLITPVVENVDAKSLSEISDITKSLATRAKERKLQPHEFQGGGFTVSNLGMFG
VREFYAIINPPQSCIMAVGQSEKRAVVVDGCVVPADVMTVTLSVDHRSVDGVLAAKFLNR
FKFYIENPLLMLV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccagttagagtattaatgccagcgctctctccaactatgaagagcggcattgtagct
aggtggcacaagaaggagggggattccgtcaagcctggcgatgtcatcgcagacatagaa
acagacaaggctgtgatggagttcgagtatgtggacgagccaggagttctgtacaagatt
ctcacgcaggaaggcacgagggatgtgccggtaaatcaggtaatagccgtagtgcgggtg
ggagatgaagacgtagcgtccgttgaggctctgtgcaatgttgcacacgacgcggatgcg
aagggctcagcagcagattcgcagggcaccgccgctgtagcggcaccggctagccctagc
gtagtcaccaacacagaaaaaccgtcgcaaccccagcctgagcgtcaacggccggaaaga
ggggtggcatatccgatacccgattttgccgaagagcgcaaaattaaggcaacaccactt
gccaaaaagctcgcttccagactttcagtagacattactaaggtcgcgggtaccggcccg
tacggcagggtggttaaggctgatgttttagatgcagcggcaggtggtggctttcccagc
acaacaggcgcagcgggaggtgatgtcgtagaggtcagcagcatgcgcagggtgatagct
gaccggttgttggaatcaaaattgacggtaccgcatttttaccttgcggtagactgcatg
gttggggaacttttgaaacttagggttgagataaacgacagctgcgctgataggggcacc
aaaattacagtgaacgattttgtgctcaaagcggtggcgctggcaatgcgggaattccct
gagatcaattcctcgtgggagggtgaccggataaggtaccacagagacataaatatatcg
tttgcagtctcaatagacggggggttgataactccggttgtcgaaaacgtcgatgcaaag
tcactgtcagaaatatctgacatcacaaaaagtctggctaccagagccaaagagaggaaa
ttgcagcctcacgaatttcagggaggtgggttcaccgtgtctaacttgggaatgttcggg
gtgcgcgaattctacgcaatcataaaccctcctcaatcttgcattatggctgtggggcag
tcagaaaagcgtgcggttgtcgtggatgggtgcgttgtacccgcagacgttatgactgtt
acactgtctgtggatcacagatcagtagatggagtgctggcagcaaagttcttgaacaga
ttcaagttttacatcgagaacccgttgctgatgttggtgtag

DBGET integrated database retrieval system