KEGG   Anaplasma marginale St. Maries: AM1347Help
Entry
AM1347            CDS       T00216                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ama01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ama00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1183943..1185145)
Genome map
AA seq 400 aa AA seqDB search
MLTFVFFVGVRVEVQGMSDVRLDDPVSLACRLMSYPSVTPDRSGAIPFLAELLSDLGFRC
EILSFGNGDVEVKNLYAQYGNGHPNLCFAGHTDVVPPGGTWRTDPFSPQVKDGMLYGRGA
SDMKAAICAYISAVARLDSVPGCLSFLITGDEEGRWREYGTKSVLDWMTKNGICPDYCVL
GEPSSRKRLGDCISIGRRGSLNFELSCRGVQGHVAYPELAHNPIDDVLCILRKIKDTTLD
SGTDHFPPSHCEITSIDVGNDVENLIPSSATAAFNIRFNDLHTAESLYRDMDAICASVTS
NYTLSHRCFGGASISQPSCYTATLCEVVKEVTGLDARLITDGGTSDACIISSFCPVAELG
LPSGTAHKVDECVSVADVLTLAEIYHRFINRFFAVAQSRS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctaacctttgtcttttttgtgggtgtgcgcgtggaagttcaaggtatgtctgatgtg
cgcctggatgacccagtgtcgctggcctgcaggctcatgtcttaccctagtgttacgccg
gatagaagcggtgccataccgttcctggcagagctgttgtcggatttagggttcaggtgc
gaaattctgtccttcggaaatggcgatgtagaggtgaaaaacctatacgcgcaatacgga
aacggccatcccaatctgtgtttcgctggccacactgatgtggtgccgcctgggggcacc
tggcgtactgatccattctccccgcaggtgaaagacggtatgctatacggccgtggtgca
tccgacatgaaggctgcgatttgcgcgtacatttctgcggttgcccggctggattcggtg
cctgggtgccttagctttcttattacaggtgatgaggaggggcgctggcgggagtatgga
accaaatctgttttagattggatgacaaagaacgggatttgcccggactactgcgtgttg
ggagagcccagtagccgtaagcgtttgggagattgcatatccatagggcgcaggggttcc
ttaaattttgagctgtcgtgtcgtggcgtacaggggcatgtcgcatatccggagctggcg
cataaccccatagacgatgtgctttgtatcttgcgtaagatcaaagacaccaccctggat
agtggtaccgaccactttcctccctcgcattgcgagataacaagtattgacgttggcaat
gatgtggagaatttaatcccgtcgtccgccactgcggcgtttaacataaggtttaatgac
ctccataccgcggaatctctataccgggacatggacgcaatatgcgcctcagtgacaagc
aactacacgctctcccataggtgctttggcggtgcatctatcagtcaaccctcttgctac
acagcaactttgtgtgaggttgtaaaggaggtaaccgggctggatgcaaggctgattacg
gatggagggacgtccgatgcatgcatcattagtagcttttgcccagtagccgagctcggc
ttgcccagcggtactgcccacaaagtagatgaatgcgtgtcagttgcagatgtgctaaca
cttgcggagatatatcacaggttcattaacaggttttttgctgttgctcagagccgtagt
tag

DBGET integrated database retrieval system