KEGG   Anaplasma marginale St. Maries: AM173Help
Entry
AM173             CDS       T00216                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ama00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AM173 (ruvA)
Enzymes [BR:ama01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AM173 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149355..149927)
Genome map
AA seq 190 aa AA seqDB search
MIGTLSGTVEEVVCSNRIILCVGGVGYLVQLPGRVLSGCQHGDHVRLYIETYVGRDGVSQ
LYGFANREEQNCMRMLIKVSGVNYKTAMAILDVLTPEQVFSAIVSEDRAALKVGGVGEKL
ISRIISELTPQVQKFELNRFAATTRTDSEAVAALLSLGYERTAALGALQKVGVCDSTEDA
VRRALLELSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggacgttgtctggcacggtcgaagaggttgtgtgcagcaatcgcatcatactg
tgtgtcggcggagtggggtatttggtgcagctgccgggcagggtgctaagcggctgccaa
cacggagatcatgttcggctgtatattgaaacctatgtgggcagagacggcgtctcccag
ctctatggctttgcaaacagggaagagcaaaactgcatgcggatgcttattaaagtcagc
ggcgtgaactacaagactgccatggcaatattggacgtgctgaccccagagcaggtgttt
tctgcaatcgtaagcgaagatagggctgctttaaaggttggtggcgtgggagaaaagctc
atcagtagaataatttccgagttgaccccgcaggtacagaaatttgagctcaacaggttc
gctgcaaccactagaacagacagtgaggctgttgctgccttactcagcctggggtacgaa
aggacggcagccttgggtgcgctgcagaaagttggagtgtgtgactccaccgaggatgcg
gtacgccgcgcacttttggagttatctaagtga

DBGET integrated database retrieval system