KEGG   Anaplasma marginale St. Maries: AM394Help
Entry
AM394             CDS       T00216                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
ama  Anaplasma marginale St. Maries
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ama00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AM394 (recR)
DNA repair and recombination proteins [BR:ama03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AM394 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350796..351437
Genome map
AA seq 213 aa AA seqDB search
MQKRAPLCVSSWLGVCADMDITKLINLFAKLPSLGPASSRRIVLHLLRHRQDVMVPLAAG
IRELEMHTKECTICHNLDTISPCSICSDKGRDQSIICVVEELGDLWAFERGRIYSGVYHV
LGGALSALSGIGPEDLNLGGIVDRIRTHGVKEVIVATSNDMDGQVTCHYIAQMVKGTDAK
VTRLACGIPLGGEIDYLDEGTLRAALSSRYVIT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagcgggcccctctttgtgtatcgtcttggttgggtgtttgcgctgatatggac
ataactaagcttataaatctttttgccaagcttccgagtttgggccctgcctcttcacgt
cgcatagtgttgcatctgctgcggcataggcaggacgtaatggtgcccctcgctgccgga
attagagagttagaaatgcacactaaggagtgcacaatctgccacaatttagacaccatt
tctccctgctccatatgttccgataagggccgggaccaaagcattatctgtgttgttgag
gagttgggtgacttgtgggctttcgagcgcgggagaatatattccggggtataccacgtg
ctggggggagcattgtctgccctctctggtattggcccggaagacctaaatctgggtgga
attgtagataggattcgcacgcatggggttaaagaagtcatcgttgcaacgagcaatgac
atggacggacaagtgacgtgccattacatagctcagatggtgaagggcactgatgccaag
gtgactaggcttgcatgtggcattcctcttgggggagagatagactacctagacgagggc
acgctacgcgcggctctctcctcaaggtacgtcattacctag

DBGET integrated database retrieval system