KEGG   Anaplasma marginale St. Maries: AM425Help
Entry
AM425             CDS       T00216                                 

Gene name
mcd
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ama  Anaplasma marginale St. Maries
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ama00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AM425 (mcd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AM425 (mcd)
Enzymes [BR:ama01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     AM425 (mcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385083..386465
Genome map
AA seq 460 aa AA seqDB search
MGSSLLKIKHRTLSSVARVVGEVTDVVMSWVGNISSDLARSQDMDKLLGKMQECVSPKGG
EVKARHNTISLGNLYLHLSDVGKAKFLRMLNDQFNSSKEDINRKISAYVNNSNADLEEKL
KFELISVLLSPRLAILRQFMSLSEGVKFLVDMRADVVTLIRKGEDFFALERDLKSVLSSL
FDVGLLDLHQITWDSPASLLEKLIFYEAVHAISSWDDLHYRLDSDRRCFAFFHYKMPGEP
LIFVEVALVDTVADNVQALLDGSIPKKDPADAKVAVFYSISNTQVGLSGINLGNFLIKRV
VERLSCEFRNIKTYVTLSPVPGFVQWLKSLTRDEVVILQKLGITHTLGEVQSLVGKVSKY
GSFALPIQEMFLKLCAHYLINEKKGNRVLDQVAHFHLSNGASVKRLNWMADKSEKGLACS
MGIMVNYYYEIAKIDDNHESYVVHGKVIASKEVSALLKKG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgggaagctcgttgctcaagataaagcatagaacacttagcagtgtggcaagggtcgtc
ggtgaggtgaccgatgttgtcatgtcctgggttggcaacataagtagcgatcttgccaga
agccaggatatggacaagcttcttgggaaaatgcaggagtgtgtcagcccgaagggtggg
gaagttaaggcgaggcacaatactatatcccttggaaatctctacctgcacctgtctgat
gtgggcaaggccaagtttctgcgtatgttgaatgaccagttcaactctagtaaggaggat
ataaaccgcaagatcagtgcatacgtaaacaacagcaacgcagatctcgaggaaaaactt
aagttcgagctcatctccgttctgctctctcccaggttggccattcttaggcagtttatg
tctctgtcggaaggagtgaagtttcttgtggatatgcgggccgatgtggttacgctaatc
agaaagggagaagattttttcgcgcttgaaagagatttaaagagtgtactgtcttcgctg
tttgatgttggcttgttagatttgcatcaaataacctgggattctccggcatcgctgctg
gaaaagctaatattctacgaggcggtgcatgcaatatcctcctgggatgatctgcactac
aggttggattccgaccgtcggtgtttcgcattttttcactacaaaatgccgggggagccg
ctgatatttgtggaagttgccttggttgacactgtggcggacaacgtgcaggcactgctg
gatggtagcattcctaagaaagatcccgctgatgccaaggttgcggttttctactcgatc
tcaaatacccaagttggtctgagtgggattaatctgggaaattttttgatcaaaagggtg
gttgagaggctttcttgcgagtttcgcaatataaagacctacgtgacgctctctcccgtg
cctgggtttgtgcagtggctcaagagcctgactcgggatgaggtggttatactacaaaaa
ttgggcattacgcacactcttggtgaggtacaatcacttgtgggcaaggtcagtaagtat
gggagctttgctctaccaatacaggaaatgttcctaaaattgtgtgcacattacctaatc
aatgaaaagaagggcaacagagtattagaccaggtcgcgcactttcacctcagcaatggt
gcgtcggttaagcggctaaactggatggctgataagtcagaaaagggactagcgtgttcc
atgggcattatggtaaattactactacgagattgccaaaattgatgacaatcatgagtcg
tacgtggtgcacgggaaggtgattgcttccaaggaagtgtcggccttgttgaaaaagggt
tga

DBGET integrated database retrieval system