KEGG   Anaplasma marginale St. Maries: AM493Help
Entry
AM493             CDS       T00216                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ama00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448016..448885
Genome map
AA seq 289 aa AA seqDB search
MQGVMSKYQINAPAKINLFLHVVGKSTSGYHVLESVFAFIKLYDTLEIEIGSKNRGVEFV
QFSGISKHDNTVQRAIGHLVRRCAPGVAKNVYVKVTKNIPVSAGLAGGSADAAAIIRLLG
KNWGISEAGMNGVAASVGSDVPVCLQSRTAFVCGMGENVKLLPHARLPNYVVLVRPNDVY
LSTRSVFDAYACKEFSKSIGNPPEASDGLLSLVMQSRNDLTDTAILLVPEVKKILAELQS
LGGCILSRMSGSGATCFALFEDGEAASDGVRYLKGRHPEWWVYETEISQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgcagggagtaatgtctaagtaccaaataaacgctccggcgaagataaacctgtttctc
cacgtagtgggcaagtctacatccggatatcacgttttggagtctgttttcgccttcatc
aagctgtatgatacgctcgaaattgaaattgggtcaaagaacaggggcgtggaatttgtg
cagttttcaggaataagcaagcacgataacaccgtgcagagggctatagggcatctggtg
aggagatgtgctccaggtgttgccaagaatgtatacgttaaagttaccaagaatatcccc
gtgtctgcggggctggctggtggctctgccgatgcagcggctattatacgtctacttggc
aaaaattggggtattagtgaagctggtatgaacggcgttgcagcatctgtagggagcgat
gttcccgtgtgtttacagtccagaacggcatttgtttgcggaatgggggagaatgtaaaa
ctcttgccacatgccaggctgccaaactacgtcgtattggtgaggccgaatgatgtatac
ttaagcactagaagcgtatttgacgcctatgcttgcaaggaattttcgaagagtataggt
aacccaccagaggcttctgacggcttgctaagcctagttatgcagtctcgcaacgatctg
actgacactgcgatattacttgtacctgaagtgaaaaaaatcctggcagaattacaatct
ttgggaggctgcattctttccaggatgagcggcagcggggccacatgctttgcactgttt
gaggatggtgaggccgcaagcgatggagtgagatacctaaaaggccggcacccagaatgg
tgggtgtacgagactgaaatctcccagtaa

DBGET integrated database retrieval system