KEGG   Anaplasma marginale St. Maries: AM559Help
Entry
AM559             CDS       T00216                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ama01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ama01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ama00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ama00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ama00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518375..519181
Genome map
AA seq 268 aa AA seqDB search
MVEHLTCNQGVVGSSPAAGSLVLSVELMSFLVVANWKMNGDTALVRDFLAAIDTSFASDL
LNKGSLELVICPPFTLMSAFDSRCPSVRLGAQNCFSGVSKGCTGEISAAMLKECGCDYVI
LGHSDRRGTFAEENSDIRLKAESAIEEGITPIICVGETLQERNSGISSDILVEQCSKCCP
KYGEFIIAYEPVWAIGGSTIPDLEIIRESFDTIRSHGSARTILYGGSVNQGNIRALKSQI
DGLSGVLVGSAGTKVDEFCGIISNVLEL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagcacctgacttgtaatcagggggttgtcggttcgagtccggcagccggctct
cttgtactgagtgtggagcttatgtcctttcttgtcgtagctaactggaagatgaatggg
gataccgctctggtgagggattttcttgctgcgattgacaccagctttgcatcggacctt
ctcaacaaaggctcgcttgaattggtcatatgccctccgtttactttgatgtcagcgttc
gactctaggtgtccatcggtaaggcttggggcgcagaactgcttttctggggttagtaaa
ggctgtactggtgagataagtgctgcaatgttaaaagagtgtggctgtgactatgtcatc
cttgggcactctgataggcgtggtacatttgctgaagaaaattcagacatcagactaaag
gctgaatccgctatagaagaggggattacacctataatatgcgttggtgagacactgcag
gaaaggaatagtggcatctctagtgatatactagtcgagcaatgcagcaaatgttgcccg
aagtacggggaatttataattgcatacgaaccggtttgggccataggaggctcaactatt
cctgatttagagataataagagaatcttttgatacaatcaggtcccatggttctgcgcgt
accatactttacggcgggtctgtaaaccagggcaacatacgcgctctaaagtcacaaatt
gatggcctatctggagtgctggttggaagtgcaggaacgaaagtagatgagttttgcgga
attataagcaatgtgttggaattatag

DBGET integrated database retrieval system