KEGG   Anaplasma marginale St. Maries: AM559Help
Entry
AM559             CDS       T00216                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ama00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AM559 (tpiA)
   01230 Biosynthesis of amino acids
    AM559 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM559 (tpiA)
   00051 Fructose and mannose metabolism
    AM559 (tpiA)
   00562 Inositol phosphate metabolism
    AM559 (tpiA)
Enzymes [BR:ama01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AM559 (tpiA)
Exosome [BR:ama04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AM559 (tpiA)
  Exosomal proteins of bladder cancer cells
   AM559 (tpiA)
  Exosomal proteins of melanoma cells
   AM559 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518375..519181
Genome map
AA seq 268 aa AA seqDB search
MVEHLTCNQGVVGSSPAAGSLVLSVELMSFLVVANWKMNGDTALVRDFLAAIDTSFASDL
LNKGSLELVICPPFTLMSAFDSRCPSVRLGAQNCFSGVSKGCTGEISAAMLKECGCDYVI
LGHSDRRGTFAEENSDIRLKAESAIEEGITPIICVGETLQERNSGISSDILVEQCSKCCP
KYGEFIIAYEPVWAIGGSTIPDLEIIRESFDTIRSHGSARTILYGGSVNQGNIRALKSQI
DGLSGVLVGSAGTKVDEFCGIISNVLEL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagcacctgacttgtaatcagggggttgtcggttcgagtccggcagccggctct
cttgtactgagtgtggagcttatgtcctttcttgtcgtagctaactggaagatgaatggg
gataccgctctggtgagggattttcttgctgcgattgacaccagctttgcatcggacctt
ctcaacaaaggctcgcttgaattggtcatatgccctccgtttactttgatgtcagcgttc
gactctaggtgtccatcggtaaggcttggggcgcagaactgcttttctggggttagtaaa
ggctgtactggtgagataagtgctgcaatgttaaaagagtgtggctgtgactatgtcatc
cttgggcactctgataggcgtggtacatttgctgaagaaaattcagacatcagactaaag
gctgaatccgctatagaagaggggattacacctataatatgcgttggtgagacactgcag
gaaaggaatagtggcatctctagtgatatactagtcgagcaatgcagcaaatgttgcccg
aagtacggggaatttataattgcatacgaaccggtttgggccataggaggctcaactatt
cctgatttagagataataagagaatcttttgatacaatcaggtcccatggttctgcgcgt
accatactttacggcgggtctgtaaaccagggcaacatacgcgctctaaagtcacaaatt
gatggcctatctggagtgctggttggaagtgcaggaacgaaagtagatgagttttgcgga
attataagcaatgtgttggaattatag

DBGET integrated database retrieval system