KEGG   Anaplasma marginale St. Maries: AM619Help
Entry
AM619             CDS       T00216                                 

Gene name
folE
Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ama00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AM619 (folE)
Enzymes [BR:ama01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AM619 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(561049..561645)
Genome map
AA seq 198 aa AA seqDB search
MHKDLARKPSDKDAEEAIEVLIRWIDDSPDMEGLSLTAGRVLNAYKESFQGYALESSHDF
RNSVFANEGYSDMILLRGVNFSSTCEHHMSPMAGVVNISYIPKATVIGVGTVVRVVDIFA
KRLQVQERMTVQIAQFLSELLKPAGVAVLIEAKHWCAKYLGGEAVSDLKLQTSCMLGEFQ
NNQNVRSEFFCRIGYKFS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggatttagcccgcaagccttccgataaagacgctgaagaggcgattgaagtt
ctgatacgatggattgatgattctcctgacatggaaggtctgtccctaacggcgggtagg
gttttgaatgcctataaggagtcttttcagggatatgcgctcgaatcatcgcatgacttt
cgcaattctgtgtttgctaacgaaggctactccgatatgatactgctacggggggtgaac
ttttcttccacgtgcgagcatcatatgtctccgatggctggggtagtgaatatttcatac
attcccaaggccactgtaattggggttggtactgtagtgagggtggtagacatatttgcc
aagcgtttgcaggtgcaagagcgtatgaccgtccaaatcgcgcaatttttgagtgaactc
ctaaagcctgcgggtgtcgcggtgctgattgaggcaaagcactggtgtgcaaaatacttg
ggaggagaggctgttagtgatctcaaattgcagactagctgcatgttaggtgaatttcag
aacaatcagaatgtgcgcagcgagtttttctgtagaatagggtataaattttcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system