KEGG   Anaplasma marginale St. Maries: AM830Help
Entry
AM830             CDS       T00216                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ama00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM830
Enzymes [BR:ama01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AM830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(770010..770813)
Genome map
AA seq 267 aa AA seqDB search
MRSVACSLSREMGGGGSVGRQGSVCLCHGRLPMGMLVLTRASADSAKSKGALEELGFDVF
VEPMFEVVHLRTEALKLQSYDVTVVTSRNGVDVIAKLTDERDICILTVGDSTMERATALG
FTNVVSAGGTVRDVISCLNAYQRGTKVLYARGEEVSYDLRGAAEKMGFEVEEAVLYKVVA
RANLSPQCCDLLMNGEILGVVFYSTRTAKIFTELSRQYSRLLRNVCAYSMSSGVFRALNV
GAWKRILVSRRPTEESLFKLLLGIERS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcggagtgttgcgtgcagtttaagtagagagatggggggggggggaagcgttggtcgc
caaggttctgtttgtctctgccatggaagattgcctatgggcatgctggtgttgacccgt
gccagtgcagactcagcaaagtccaaaggggctctagaggaattggggttcgacgttttt
gttgagcccatgtttgaagttgtgcatctgcgtactgaggccctaaagttgcagtcatat
gacgtcactgttgttacgagcaggaatggtgttgatgttatcgccaagcttactgacgaa
cgcgatatctgcatattaactgtgggtgacagcaccatggagcgcgcgactgctcttggg
tttactaatgtggtatctgcgggtggcaccgtgcgcgatgtaatatcttgcctgaatgcg
taccaacgcggaaccaaggtgctatacgcgagaggggaggaagtttcatacgatttgcgc
ggtgctgcagagaaaatgggttttgaggtagaagaggctgtgctctacaaggttgtagct
agagcgaatctgagcccccagtgctgtgatctgctcatgaatggtgagatattgggtgtg
gttttttactcaactaggacggccaagatttttaccgagttatccagacaatacagcagg
cttctgcgtaatgtttgtgcgtattctatgagcagcggggtttttcgcgcactgaatgtg
ggtgcgtggaagcggatacttgtttctcgacgccccactgaggagtcattgtttaagtta
ttgttaggcattgaaagatcataa

DBGET integrated database retrieval system