KEGG   Anaplasma marginale St. Maries: AM975Help
Entry
AM975             CDS       T00216                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ama  Anaplasma marginale St. Maries
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ama00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AM975
Enzymes [BR:ama01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AM975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891166..891870
Genome map
AA seq 234 aa AA seqDB search
MYPPTYTRQPTAPHFSSIGCPGRLKPHAPQVDIWGQCVRWQAQKSLAKISRQCNNALHVP
TNNGNVDVVVLALGSNVGSRKNNLEAAVRLLPIYNGHCSYIYETRALLPDGAPTWWDMPY
LNMVMCGYVNLSPDELLGCIKRVEYTLGRSNTGTWGPRPIDVDILLYDGLSMQSDTLTIP
HKEMHKRDFVLVPACDVCARFPHTVLKTTLETILSSMQEVDVVKKYGPLSCTRT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgtacccaccaacctatacccgccaacctacggctccgcattttagcagtataggttgc
cctggaagattaaagcctcacgccccacaggtggacatatggggccaatgcgttagatgg
caagctcaaaaatcactcgctaaaatttcgcggcaatgcaacaatgccttgcatgttcca
acaaacaacggaaatgtagacgtggtggtgctggcactgggtagcaacgttggctcgaga
aagaacaatttagaggctgctgtcaggttgctccccatctacaacgggcattgttcgtat
atatacgaaaccagggctttgctaccggatggggcacctacttggtgggacatgccgtac
ctcaacatggtaatgtgtggctacgtaaatctgtctccagatgagctgctggggtgcata
aagcgcgtggagtatactttgggaagaagcaacactgggacatggggcccaagacctata
gatgtggacatactactgtacgatggcctgtcgatgcagagtgacaccctcactataccg
cacaaagagatgcacaaaagagatttcgtcctcgtaccagcatgcgatgtctgcgctagg
ttcccccatactgtgctcaaaaccacgctagaaactattctatcgtcaatgcaggaagta
gatgtggtcaaaaagtacggcccgctgagctgcacccgcacgtag

DBGET integrated database retrieval system