KEGG   Alteromonas macleodii AltDE1: amad1_00680Help
Entry
amad1_00680       CDS       T02340                                 

Definition
uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amaa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(154596..155327)
Genome map
AA seq 243 aa AA seqDB search
MLLFTRPLPKLKASALAFENAGIDAVGVATSDIVPVLSEQYAAAEFLSHNAINVIIVTSV
YAVDTVVSGLKKTAAAPPLVVAVGDATAHKLRAGLSELSSVNIAIPKVHTSEGILAMHQL
NEANCQQVVIIKGEGGRDAIANGLDEKGMSVNSFCVYKREPLTRPIYTKRWKLGEVSGII
ATSEAMALQLIEQFGNALLAYPWLTVSSRIAKTLTNKGIEEVAVCQRATDQALIAWVKEN
WEY
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctactgttcacacgccctttaccaaaattaaaagcgagcgcgttagcttttgaaaat
gctggaattgatgcggtaggtgtagctacgtctgatattgtcccagtactttcagagcaa
tatgctgcagctgaatttttatctcacaacgcgataaacgtaattattgttaccagcgta
tatgctgtagataccgtcgtttcggggttgaagaaaacagcggcagcccctccccttgtt
gttgcagtgggcgacgccaccgcacataaacttcgtgcagggctgagcgagctatcatcc
gtcaatattgccattcctaaggttcatacatccgaaggtatactggcaatgcaccaactt
aatgaggcaaactgtcaacaagtcgttattattaaaggtgaaggtggaagggacgctatc
gctaatggattagacgaaaaagggatgtcagtgaacagcttttgcgtttataaaagggaa
ccacttacgcgcccaatttacacaaaacggtggaaactgggcgaagttagcggcattatc
gctacaagcgaagcaatggcactgcagcttatagaacaatttggcaacgcgcttttagct
tatccatggctaacagtaagcagccgcattgctaaaaccctcaccaataaaggtattgaa
gaggttgccgtttgtcagcgagccaccgatcaggcactcatcgcctgggtaaaggaaaac
tgggagtattga

DBGET integrated database retrieval system