KEGG   Alteromonas macleodii AltDE1: amad1_01170Help
Entry
amad1_01170       CDS       T02340                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    amad1_01170
Enzymes [BR:amaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     amad1_01170
Exosome [BR:amaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   amad1_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(263905..265389)
Genome map
AA seq 494 aa AA seqDB search
MGQHILAIDQGTTSSRSIIFSPKGSIDAIAQQEFSQKYPKDGWVEHDPEEIWESVVSTLK
EVFNKCSVAPSDIAAIGITNQRETTLVWDKHSGKPVYNAIVWQDRRTAQYCRDFSEDEAF
VSYITEATGLLLDPYFSATKIAWILDNVEGAREKAENGDLLFGTVDSYLIWRLTGGESHK
TDATNASRTMLFDIHNQCWDEKLLSKFNIPVSMLPEVMDCAADFGVIKEEIIGRAIPIQG
VAGDQQAALVGQACFEKGMAKSTYGTGCFMILNTGDAPLQSKNRLLTTVGYRLNGKTTYA
LEGSIFMAGATVQWLRDGLKLIDDAAESEALAQRAREDNGVFLVPAFTGLGAPYWDPDAR
GAILGLTRDTGISEIVAAGLQSVCYQTKDLQKAMESDGARPTTIRVDGGMSRNDWVMGFL
SDILGAEVERPEITETTALGAAFLAGLHAGIFNSVDDLTHCWKSDSVFTPRLTKQERDQA
YDGWKSAVARIRCS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgggacaacatattctcgccattgaccaaggcacaacaagctctcgcagtattattttt
tctccgaaaggcagcattgatgccattgcgcaacaagagttctctcaaaaatacccaaag
gacggctgggtggagcacgatcccgaagagatttgggaaagcgttgtatctactctgaaa
gaagtttttaacaaatgtagtgtcgctccatctgacatcgccgccattggtattaccaac
cagcgcgagacaaccttggtatgggataaacactcaggtaaacccgtatacaatgcaatc
gtgtggcaagacagacgcactgcacaatactgccgtgattttagcgaagacgaggcgttt
gtttcttatataaccgaagcaacagggcttttactcgacccttacttctcggccacgaaa
atcgcatggatattagataacgtggaaggcgcccgcgagaaagcagaaaacggcgatctg
ctctttggcacagtggattcatatcttatttggcgtctaaccggcggtgaatcgcataaa
accgacgcgactaatgcgtcgcgcaccatgttatttgatattcacaaccagtgttgggat
gaaaagctattaagtaaattcaatatccctgtctcaatgttacctgaagttatggattgt
gcagctgacttcggcgttattaaagaagagattattggtagggccatccccatccagggc
gttgcaggcgaccagcaagccgcattggtaggccaagcctgttttgaaaaaggcatggca
aaaagtacctatggaacgggttgctttatgattttaaataccggcgatgcgcccctgcaa
tcaaaaaaccgcttacttaccacggtaggttaccgacttaatggcaaaaccacctatgca
ttagaaggcagtatatttatggctggcgccacggtgcaatggcttcgcgatggcttaaaa
cttatcgacgatgccgctgaatcagaagcacttgcgcagcgtgccagagaagacaatggc
gtgtttctagtacccgcatttactggcctaggcgcgccttattgggatccagacgcgcgc
ggggcgattttagggttgacgcgagatactggcattagcgaaatagttgccgctggctta
cagtctgtatgctatcaaactaaagaccttcaaaaagcgatggaaagcgacggtgctcgc
cctacaacaatacgcgtagacggcggcatgtcgcgtaatgactgggttatgggcttctta
tccgatattttaggtgccgaggttgaacggcctgaaataacggaaaccacggcgctaggc
gctgcatttctagcggggttacacgctggaatattcaattctgtagatgacttaactcac
tgctggaagagtgatagcgttttcactcctagattaaccaagcaagagcgcgatcaagcc
tatgacggctggaaatcggctgttgcccgcatccgctgtagctaa

DBGET integrated database retrieval system