KEGG   Alteromonas macleodii AltDE1: amad1_02185Help
Entry
amad1_02185       CDS       T02340                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:amaa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:amaa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(485962..486975)
Genome map
AA seq 337 aa AA seqDB search
MSDFTGNHILSVNQFDREAIEKVFSVANSMKPYATRQKRTTVLDGAILGNLFFEPSTRTR
VSFGTAFNLLGGEVRETTGMSSSALAKGESLYDTARVLSGYSDIIAMRHPAAGSVAEFAE
GSRVPVINGGDGANEHPTQALLDLFTIKRELEYNGHGIDGLHIAMIGDLRYGRTVHSLSR
LLCLFNNIRFTLISPKELAMPQPIIDAIENAGHQLTITDTLEGNMDADICYQTRIQEERF
PSQEEANKYRGKFRLNQSIYTKHFQSKTVIMHPLPRDSRMEANELDNDLNLNPNLAIFRQ
TDNGVLVRMALFALTLGVENLLTKYERDVVWYSNKSK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactttaccggtaaccacattctttcggttaatcaattcgatcgcgaggccatt
gagaaagtcttctcagttgccaattctatgaagccctatgccacgcggcaaaagcgcacc
acggtgcttgatggcgctattctcggtaaccttttctttgaacctagcactcgtacccga
gtgagtttcgggactgcctttaatctattaggcggcgaggtaagagaaactaccggcatg
tcgagttcggcgctagcaaaaggggagtcgctttacgatacggcacgtgtgttaagcggc
tactccgacattatcgccatgcgccaccccgcggcaggctccgtagctgagtttgcagaa
ggcagccgcgtaccggtaatcaatgggggcgacggcgcgaacgagcaccctactcaggcg
ctgcttgaccttttcacaattaaacgggaattggaatacaatggtcacggcattgacggt
ttgcacattgccatgattggggacttaagatacgggcgcacggtacactctctatcgcgc
cttttgtgcttgtttaacaatatccgctttacgcttatttcgccaaaagagctggcgatg
ccccagcccatcattgatgcgattgaaaatgccggccaccaacttaccattactgacacc
cttgaagggaatatggatgcagatatctgctatcaaacccgcattcaggaagagcgcttt
ccatcgcaagaagaagccaacaaataccgtggtaaatttagacttaatcagtctatttac
accaaacactttcagtcaaagaccgttattatgcatccacttcctcgcgattcacgtatg
gaagccaacgaattagataacgatctaaaccttaatccgaacctcgccatttttaggcaa
accgataacggtgtgcttgtgagaatggcattatttgcattaacacttggggtagaaaac
cttctcaccaagtacgaacgcgatgtggtttggtacagcaacaagagtaagtaa

DBGET integrated database retrieval system