KEGG   Alteromonas macleodii AltDE1: amad1_02435Help
Entry
amad1_02435       CDS       T02340                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    amad1_02435
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     amad1_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
545984..546952
Genome map
AA seq 322 aa AA seqDB search
MNWAFTSENNLASTFATDINPFWQHSVTQGHFVGKDNITVRYSHCIPKSPRATIVICSGR
IESYLKYKEFIYDLYQNGFAVFILDHRGQGLSDRMTSDPQHGYVAHFDDYVDDFVTFVET
IVKPKHQGPLLLVCHSMGGAIGALTLLRMPKLFSKAVFASPMFGIKPSLPNWLANGLIRT
GLAVNRMKKADSGYFFGQTPYIAFPFALNKLTHSKTRYALFRELYDEEQDIQLGGVTTEW
LAAAHQAMNKIENSAGAITTPTLVLSADDDAIIDNKRQRLVAQRMPNATLEIVPRAYHEL
FTESDDIRERSLTRILDFLTES
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggcgttcacgtctgaaaataacttagctagcacttttgctacagatattaat
cctttttggcagcacagcgtgacgcagggccatttcgtaggaaaagacaatatcacagtg
cgctattcgcattgtattcctaagtcgcctcgcgcaacgattgtgatttgttcagggcgt
attgagtcttacttaaaatacaaagagtttatttacgatctctatcaaaatggctttgcc
gtttttattcttgatcaccgaggtcaaggcctatctgaccgaatgacaagcgacccgcag
catggctatgtagcccacttcgatgattacgtagatgactttgtcacatttgtagaaacc
attgttaagcctaagcatcaagggcctttattgttagtgtgccactcgatgggtggagca
ataggcgcattgactttactgcgcatgccaaagcttttctctaaagccgtatttgcatca
ccgatgtttggcattaagccatcgctgcctaactggctagcaaacgggctaatacgcact
ggccttgcggttaatagaatgaaaaaagccgattcaggctacttcttcgggcagacaccg
tatatcgcctttccatttgcactgaataaactgacgcatagtaaaacccgctacgcacta
ttccgcgaattgtatgacgaagagcaggatatacagctaggcggcgtgaccactgaatgg
ttagcggcagcccaccaggcaatgaataaaattgaaaacagcgctggggccattaccacc
cccacactggtattaagtgccgatgacgatgctattatcgataataagcgccagcgtctt
gtagcgcagcgtatgcctaacgcaacgttagaaattgtacctcgtgcttatcatgagctc
ttcaccgagtctgacgatattcgtgaacgctcgctcacccgcattctcgattttcttaca
gaaagctaa

DBGET integrated database retrieval system