KEGG   Alteromonas macleodii AltDE1: amad1_02700Help
Entry
amad1_02700       CDS       T02340                                 

Definition
beta-hexosaminidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    amad1_02700
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    amad1_02700
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     amad1_02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602546..604609
Genome map
AA seq 687 aa AA seqDB search
MLFQQVICKKHVSVMGEIRIALGFLAITFLAGITSAQPLSANAPVNLTTGKSSSIQKGGA
QGGIQQNADSLSTIKAMLGQKIILDFRYFCEDDTPSSQCRTPMTKIPASLLALLSSHNIG
GVILFSENIENNEQLITLNYTMQQHMLKAGKQPLFIAIDQEGGRVARLPSDILAPFAGNM
AIGATFHQHGSTFAQRVARHIGKTLLPLGINTNFAPSVDINSEPKNPVINVRSFSEHPEQ
VAALGQTFVEAMQGTGVISTIKHFPGHGDTHVDSHSGLPLVSHTRAQAMTGDILPFSNII
RSATPPAMVMSAHIQYPSLDDTRITDKNGKRQIVPATLSKKILTNLLRKQLGYKGLIVTD
ALDMAGITQFFSHEEALVRAFSAGADIALMPFTIRNKTDINAFAKLLDNVAVKLADSALD
ISSESAFLISSYNRIIESKQRFTLDGFISKPKVWWLDEANDNALTDNPNSLKNKGIRIEK
ALSEGSVSVLFGKEKLPITSTRWLALMPDAARCLAFEAALAHASSKSTNKPLEFACLPLT
ALPNTQLAMDLLQQAEALIVGNISPLHATYELGGFDLPEHVKRRARETEVMAFSKKIMSA
AKTQNKTVVFAPLRMPYSAQDVKSMTDIAIATFSYAISVSAQGSKEENKDDQKVTSYSLN
ALADVLLGNTAAKGRSPVSLDSLSLQK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
ttgttattccagcaagttatttgtaaaaaacacgtctctgttatgggggaaatacgtata
gccctaggctttttagcgattacttttttagcgggtataacttctgctcagcccttaagt
gctaacgccccggtcaacttaaccacaggtaagagttcctctattcaaaaagggggcgca
caaggcggtatacagcaaaacgcagatagtcttagcaccatcaaggccatgctgggccaa
aagatcattttagattttcgctatttctgcgaagacgacacaccatcatcgcaatgccgc
acaccaatgacgaaaatccctgcaagtttgctggcactattaagtagtcacaacattggt
ggcgtgattctgttttcagaaaacattgaaaataacgagcagttgataacgctaaattac
actatgcagcagcatatgttgaaagcgggcaagcaaccattatttatcgctatcgatcaa
gagggcggtagggtagcgcgcctgccctcagacatattagcgccatttgccggtaatatg
gcaattggtgcgacgtttcatcaacatggcagtacttttgcgcaacgcgtggctcgccac
atcggtaaaacgctcttaccccttggtattaacaccaactttgccccatcggttgatata
aacagcgagccgaaaaacccggttataaacgtgcgcagtttttcagaacacccagagcag
gttgctgcgctaggccaaacgtttgttgaagcaatgcaggggacgggcgtgataagtaca
attaagcattttccaggtcatggcgacacgcatgtggatagtcacagcggtcttccgctg
gtaagtcatacccgagcacaagcaatgacgggtgatattctgccgttttctaatattatt
agaagtgccacaccgccggccatggtaatgagtgcacacattcagtatccatcgttagac
gataccagaattacagacaagaacggaaagcgacaaatagttccagcgactttgtcgaag
aagatattaaccaacttgcttcgcaagcaactggggtataaaggtctaattgttactgac
gctctagatatggcgggtattacacagttcttctcgcacgaagaggctttagttcgcgca
tttagtgcgggcgcggatattgcgcttatgcctttcactataagaaataaaacggatata
aatgcgtttgcaaagcttctcgacaatgtagcagtaaaactcgcagatagcgcattagac
atatcatcagaaagcgctttcttgatatcttcatataatcgtattatcgaatcaaaacaa
cggtttacgctagatggttttatttccaagccgaaggtctggtggcttgatgaagcaaac
gacaatgcattgactgataaccctaacagtttaaaaaacaaaggaattagaatagagaaa
gcgctttctgagggttcggtgtctgtgcttttcggaaaagaaaaactaccgataacatca
acgcgctggttggcgctaatgccggatgcggcgaggtgtttagcatttgaagccgcactt
gcacatgctagttctaaaagcaccaataagcctctagagtttgcttgtttacccctaacc
gcgctacctaacacccaactagctatggacctattacagcaggctgaagctttaatagta
ggtaatattagcccgcttcacgcgacctatgagttaggtgggtttgatctacctgagcat
gtgaagcgacgtgcgcgtgaaactgaggtgatggcatttagtaaaaagataatgtctgct
gcaaaaacacaaaataaaaccgtagtttttgcaccgctacgtatgccgtatagtgcacaa
gatgttaaaagcatgacagatattgctattgccacattcagttatgccattagtgtaagc
gcccaaggtagcaaagaagaaaacaaagacgatcaaaaggttaccagctatagtctgaac
gcactagctgatgttttattaggtaacacggctgctaaaggccgttcacccgtttcgtta
gactcactttcactacaaaagtag

DBGET integrated database retrieval system