KEGG   Alteromonas macleodii AltDE1: amad1_04860Help
Entry
amad1_04860       CDS       T02340                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:amaa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1080285..1081472
Genome map
AA seq 395 aa AA seqDB search
MQTVTVLGATGSIGCNTLDVINRHPDKYRVFAITGNSQLELLMEQAQKCAPRYVVIADDA
NYKLACELASQYGVDAEILAGVKALEEVSSAPEVDAVMAAIVGAAGLLPTMAAVKAGKRV
LLANKEALVMSGALFIEAANQSGAEILPIDSEHNAIFQCLPHDYEYGNFAASGIRKILLT
GSGGPFRERPLDSFSSITIDEASTHPNWSMGRKITIDSATMMNKGLEFIEACWLFGAGAD
DIDVVIHPQSIIHSMVQYIDGSVIAQMGNPDMRTPIAYGLAHPARIEAGVKPLDFSDIAN
FSFQTPCFKRYPNLKLAIDACKEGQCATTRMNAANEVSVAAFLDGNIQFCDIAKVNEATL
NAMPYVSVSSIQQILEQDTLARVKADEIIRGKFQC
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagtaacagtgttaggggccacaggctccattggttgtaatacactcgacgta
ataaaccgccacccagacaagtatcgtgtatttgctattactggcaactcacagcttgaa
ttgcttatggagcaggcccaaaaatgcgcgccgcgctatgtggtaattgctgatgacgca
aactacaaactagcctgtgagttagcatcccagtacggtgtggatgcagaaattctcgct
ggtgttaaggcgctggaagaagtatccagcgcgcctgaagttgatgctgtaatggcagcc
attgtgggtgcagcagggcttttacccacaatggcagcagtaaaagcgggtaaaagggtt
ttgcttgccaataaagaagcgttagtcatgtctggtgctttatttatcgaggctgcgaac
caaagcggcgctgaaattcttcctatcgacagcgaacacaacgccatattccagtgcctc
ccgcacgattatgaatacggtaactttgctgcatccggcattcgtaaaattctcttaacc
ggttctggtggtccgtttagagaaaggccacttgatagcttctcatcaattacaatcgat
gaagccagtacacaccctaactggtcgatgggcagaaaaattacaatcgactctgcaact
atgatgaacaaggggctggagtttattgaagcctgttggctgttcggtgctggcgcagat
gatattgatgtggttattcacccgcaaagtatcattcattccatggtgcaatatattgat
ggctcggttatcgcgcaaatgggtaacccggatatgcgaacgccgattgcttatggctta
gcgcatccagcgcgcatcgaagcgggggttaagcccctagacttttcagatattgctaac
tttagctttcaaacgccttgtttcaagcgctaccctaatttgaaattggccattgatgcc
tgcaaagaagggcagtgtgcaacaacacggatgaatgcggccaacgaagtatcggttgcg
gcctttttagacggtaacattcagttttgtgatattgcaaaagtaaatgaagctacgcta
aacgccatgccttacgtttctgttagttctattcagcaaatacttgagcaagatacttta
gcccgagttaaagctgacgagattattcgaggtaaattccagtgctag

DBGET integrated database retrieval system