KEGG   Alteromonas macleodii AltDE1: amad1_05385Help
Entry
amad1_05385       CDS       T02340                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amaa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amaa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195146..1196276
Genome map
AA seq 376 aa AA seqDB search
MVFKVLVVDDSTFYRRRVKEILDDDRELEVVGEARNGRDALEKAEALKPDVITMDVEMPV
MDGISAVKAIMEKRPTPILMFSSLTHHGAQATLDALEAGALDFLPKKFEDIAQDRKDASR
LLCTKVRLIARRGIGLKRPSFRATETRKLPDNAPKQAFFKTSGLLSGHKDAAKQPTVSSV
RATGKQYKCLAIGASTGGPVALQKVLSPLPAEFPYPIFLVQHMPGTFTTAFAQRLDSNCN
IKVKEAEHGDIVEPGHAYLAPGGKQMLLETIGANKRIAIVDASASDKVNYKPSVDLTFSS
LAKAYGGDVLGVILTGMGADGKEGCRMLKDKGATIWAQDQDSCVVNGMPQAVAAANISSK
SINIDDISSCVQAEMR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaaagtcctagtggtggacgactcgacattttatcgtcgtcgagtaaaagaa
atactcgacgatgatagagagcttgaagttgttggggaagcaagaaacgggcgcgatgcc
ttagaaaaagcagaggcacttaaacctgatgtcataacaatggatgtggaaatgcccgta
atggacggcatttcggcggtaaaggctatcatggaaaaacggcctacgccgatcctcatg
ttctcttcgcttactcatcatggagcgcaagctacactcgatgcactagaagccggtgca
ctcgacttcttgccgaaaaaatttgaagatattgctcaagatagaaaagatgcatcgcgc
ttattatgtactaaagttaggttaatagcgcgtcgaggtattggccttaagcgtccatct
tttagagccacagaaacaagaaagctaccggataacgcacccaagcaggcgttttttaaa
acatcggggttactttctggccataaagacgcggcaaaacagcccaccgtctcatctgta
agggcgacgggaaagcaatataaatgcttggcgataggtgcatctacaggtggtcctgtg
gcgctacaaaaagtgctgtcaccactacctgcagaatttccatatcccatttttcttgtc
caacatatgccgggcacatttaccacggcatttgctcagcgcttagattcaaactgcaat
ataaaagtaaaagaagctgagcatggcgatatagtggagccgggccacgcttatttagcg
ccgggcggtaaacagatgttgttagaaaccataggcgcgaataagcgtatagctattgtc
gatgcaagtgcgagcgacaaggttaattataagcccagcgttgatttaacgttcagctcg
ctggccaaagcctatgggggagatgtattaggcgtcattttgacaggcatgggcgcagac
ggcaaagaagggtgccgcatgctgaaggacaaaggtgcgactatttgggcacaagaccaa
gactcctgtgtggtgaatggcatgccccaagccgtagccgctgctaatatatcaagtaaa
agcattaatattgacgatattagcagttgcgttcaagccgaaatgcgatag

DBGET integrated database retrieval system