KEGG   Alteromonas macleodii AltDE1: amad1_05385Help
Entry
amad1_05385       CDS       T02340                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amad1_05385
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    amad1_05385
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     amad1_05385
Two-component system [BR:amaa02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   amad1_05385
Bacterial motility proteins [BR:amaa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    amad1_05385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195146..1196276
Genome map
AA seq 376 aa AA seqDB search
MVFKVLVVDDSTFYRRRVKEILDDDRELEVVGEARNGRDALEKAEALKPDVITMDVEMPV
MDGISAVKAIMEKRPTPILMFSSLTHHGAQATLDALEAGALDFLPKKFEDIAQDRKDASR
LLCTKVRLIARRGIGLKRPSFRATETRKLPDNAPKQAFFKTSGLLSGHKDAAKQPTVSSV
RATGKQYKCLAIGASTGGPVALQKVLSPLPAEFPYPIFLVQHMPGTFTTAFAQRLDSNCN
IKVKEAEHGDIVEPGHAYLAPGGKQMLLETIGANKRIAIVDASASDKVNYKPSVDLTFSS
LAKAYGGDVLGVILTGMGADGKEGCRMLKDKGATIWAQDQDSCVVNGMPQAVAAANISSK
SINIDDISSCVQAEMR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaaagtcctagtggtggacgactcgacattttatcgtcgtcgagtaaaagaa
atactcgacgatgatagagagcttgaagttgttggggaagcaagaaacgggcgcgatgcc
ttagaaaaagcagaggcacttaaacctgatgtcataacaatggatgtggaaatgcccgta
atggacggcatttcggcggtaaaggctatcatggaaaaacggcctacgccgatcctcatg
ttctcttcgcttactcatcatggagcgcaagctacactcgatgcactagaagccggtgca
ctcgacttcttgccgaaaaaatttgaagatattgctcaagatagaaaagatgcatcgcgc
ttattatgtactaaagttaggttaatagcgcgtcgaggtattggccttaagcgtccatct
tttagagccacagaaacaagaaagctaccggataacgcacccaagcaggcgttttttaaa
acatcggggttactttctggccataaagacgcggcaaaacagcccaccgtctcatctgta
agggcgacgggaaagcaatataaatgcttggcgataggtgcatctacaggtggtcctgtg
gcgctacaaaaagtgctgtcaccactacctgcagaatttccatatcccatttttcttgtc
caacatatgccgggcacatttaccacggcatttgctcagcgcttagattcaaactgcaat
ataaaagtaaaagaagctgagcatggcgatatagtggagccgggccacgcttatttagcg
ccgggcggtaaacagatgttgttagaaaccataggcgcgaataagcgtatagctattgtc
gatgcaagtgcgagcgacaaggttaattataagcccagcgttgatttaacgttcagctcg
ctggccaaagcctatgggggagatgtattaggcgtcattttgacaggcatgggcgcagac
ggcaaagaagggtgccgcatgctgaaggacaaaggtgcgactatttgggcacaagaccaa
gactcctgtgtggtgaatggcatgccccaagccgtagccgctgctaatatatcaagtaaa
agcattaatattgacgatattagcagttgcgttcaagccgaaatgcgatag

DBGET integrated database retrieval system