KEGG   Alteromonas macleodii AltDE1: amad1_06910Help
Entry
amad1_06910       CDS       T02340                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    amad1_06910
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     amad1_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1532874..1533494
Genome map
AA seq 206 aa AA seqDB search
MIGRIRGTLAEKQPPEILVDVAGVGYEIHMPMTSFYQLPAVGEEVVVYTHFVVREDAQLL
FGFADKMERGLFRELIKANGVGPKLGLAILSGMSAGQFLASVQNEDVSALVSLPGIGKKT
AERLVVELKDRLAKFGKAQSIAVPPPSGDLLSPNTIVEVNDAREEAQSALIALGYKPAQA
SKLVESVYSEGMESEALIREALKAAI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgataggacgaattcgcggtacgttggctgaaaaacagccaccagaaattcttgtagat
gtggccggtgttggctacgaaattcacatgcctatgacgagcttttatcagcttccagca
gtgggtgaagaagtcgtggtatacacgcactttgtggttcgcgaagacgcccaactgctg
tttggctttgccgacaaaatggagcgaggtttatttcgcgagctaattaaagcaaacggt
gttggtccaaaacttggtttggctattttatccggcatgtcggcaggtcagttcttggca
agcgtgcaaaacgaagatgtatctgcgctggtgagtttacccggcataggtaagaaaacg
gccgagcgtttagtggtagaacttaaagaccgattagctaagtttggcaaagcgcagagt
attgctgtcccgcctccgagtggcgacttgttatcgccaaacactattgttgaagttaac
gacgcgcgggaggaagcgcaaagcgcacttatcgcgttaggttataagcccgcgcaggca
agtaagttagttgaaagcgtttatagcgagggcatggaaagcgaagcccttattcgcgaa
gcgctaaaagcggccatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system