KEGG   Alteromonas macleodii AltDE1: amad1_07280Help
Entry
amad1_07280       CDS       T02340                                 

Definition
lipase/acylhydrolase, GDSL family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    amad1_07280
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     amad1_07280
   3.1.2  Thioester hydrolases
    3.1.2.-  
     amad1_07280
Lipid biosynthesis proteins [BR:amaa01004]
 Fatty acid synthase
  Component type
   amad1_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1616576..1617232)
Genome map
AA seq 218 aa AA seqDB search
MFVKFRYLFAFVLIILIPFQALSDQGEQGDTSEKAVLLILGDSLSAAYGLQQHQGWVSLL
QKMWEDDNIPIDIVNAAVSGETTDGGLARFPRLLDQHTPSHVLIELGGNDGLQGHNINKI
KNNLNSLVNVAKENNAVVFLQEMQIPSNYGRRYTQMFTQNFSKVADEQDIATIPFFLEEI
ALNQELMQNDGIHPNAEAQPLIANFMDRHLRSLILDVQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgttaaatttcgttatttattcgcttttgtacttattattttaataccctttcaa
gcgctatcagatcaaggtgagcaaggtgacacaagcgaaaaggcggttttgcttatttta
ggtgacagtctatctgcggcctacgggttgcagcaacatcaaggctgggtcagtttgtta
caaaagatgtgggaagacgacaacattccgattgatattgtaaatgctgcggtaagtggt
gaaacaacagatggcggattagcgcgctttccgcggttattagatcaacatacgccatcc
catgtattaattgaattaggcggtaacgatgggcttcaagggcataacataaacaaaata
aaaaataacttgaattcattagttaatgtggcgaaagaaaacaatgccgttgtatttctt
caagaaatgcagatcccttcgaattacggtaggcgttacacgcaaatgtttactcaaaac
ttcagcaaagtggctgacgagcaagatatagcaacgattcccttttttcttgaagaaata
gcgcttaatcaagaattaatgcaaaacgatggcattcatcccaacgctgaggcacagcct
ttgattgctaattttatggacagacacttaagaagtttaattcttgatgttcaataa

DBGET integrated database retrieval system