KEGG   Alteromonas mediterranea DE1: amad1_09185Help
Entry
amad1_09185       CDS       T02340                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00071  Fatty acid degradation
amaa00072  Synthesis and degradation of ketone bodies
amaa00280  Valine, leucine and isoleucine degradation
amaa00310  Lysine degradation
amaa00362  Benzoate degradation
amaa00380  Tryptophan metabolism
amaa00620  Pyruvate metabolism
amaa00630  Glyoxylate and dicarboxylate metabolism
amaa00640  Propanoate metabolism
amaa00650  Butanoate metabolism
amaa00900  Terpenoid backbone biosynthesis
amaa01100  Metabolic pathways
amaa01110  Biosynthesis of secondary metabolites
amaa01120  Microbial metabolism in diverse environments
amaa01130  Biosynthesis of antibiotics
amaa01200  Carbon metabolism
amaa01212  Fatty acid metabolism
amaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    amad1_09185
   00630 Glyoxylate and dicarboxylate metabolism
    amad1_09185
   00640 Propanoate metabolism
    amad1_09185
   00650 Butanoate metabolism
    amad1_09185
  Lipid metabolism
   00071 Fatty acid degradation
    amad1_09185
   00072 Synthesis and degradation of ketone bodies
    amad1_09185
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    amad1_09185
   00310 Lysine degradation
    amad1_09185
   00380 Tryptophan metabolism
    amad1_09185
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    amad1_09185
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    amad1_09185
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amad1_09185
Enzymes [BR:amaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     amad1_09185
Exosome [BR:amaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   amad1_09185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AFV85346
Position
2052035..2053216
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIENAVSRAGIDPASVDDVIMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANAIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITAVQAVFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGSAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagtaattgtaagtacagcacgtacaccaataggccgtgcctataaaggc
gcactaaacaacttacccgcgccgtcgttaggtggtcatgccattgaaaatgcggtatct
cgtgcgggtattgaccctgctagcgtagatgacgtcatcatgggcgcagcgctcacacaa
ggcagcggtggtatgaacatcggccggttagccgggcttgccggcggccttcctgttacg
gttgcgggtatgacccttgaccgtcaatgtagttcaggtatgtacgccatcgctacagca
gcaaatgctattcgtactggcgataccaacattatggtagccggtggtttagattctatt
tcactggtacaaaacaagaacatgaatatgttccgtgccgttgaccctgcacttgttgct
aagcacaaagatatctacatgccgatgcttcaaaccgctgaagtggtaggcaagcgttat
aacattagccgcgatgtacaagatgagtacggctaccaaagtcaaatgcgcacagcagca
gcgcaagaggccggtaagtttgacgacgaaattgtacctattacagcagttcaagcggtg
ttcaataaagaaacgggtgaaacctctgagcgcgaagtcaccttgtctaaagatgaaggt
aatcgcccagaaactactcttgaaggtttgaaagcgttaaaccctgttattgaaggcggc
tgcattacagctggcaacgcgagccagctttcagacggcgcaagtgcaacagttattatg
gatgagcagtcagcagcgaaaggcagtgctcagccacttggtatttatcgcggtattgca
gtggcaggctgtgaacctgatgaaatgggaattggcccggtattcgccattcctaagcta
ttaaagcagcatggattaaccatggacgatatcggtctatgggaacttaacgaagcattt
gcagtacaggtactctactgccgcgacaagttaggtattccagacgaattattaaatgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
cacgcactcatcgaaggtaaacgacgtggtgcgaaatatgtagtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagttatatag

DBGET integrated database retrieval system