KEGG   Alteromonas macleodii AltDE1: amad1_10285Help
Entry
amad1_10285       CDS       T02340                                 

Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amad1_10285
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amad1_10285
   00650 Butanoate metabolism
    amad1_10285
  Energy metabolism
   00190 Oxidative phosphorylation
    amad1_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2281978..2282325
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLAALVAVMIHVRIGLWQVLTDYVKATGLRAVLQYILNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcataaagcgtgacggcgtacaagactacgtatctcttcgc
gcaacagcagcgataattttcgcgtactcggttttcatggcgtggttttttattaccacc
gataacttaacgtttatcgaatggcgaggtttgttctctggcctagctatgaaagttttc
acattggcagcactagtagcagtgatgatccacgtgcgtatcggcctttggcaggtactt
acagactatgttaaagcgacaggtctacgtgcggtactacaatatatattaaatatcatc
gcgttcggctacgtagctgtgggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system