KEGG   Alteromonas macleodii AltDE1: amad1_10305Help
Entry
amad1_10305       CDS       T02340                                 

Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amad1_10305
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amad1_10305
  Amino acid metabolism
   00310 Lysine degradation
    amad1_10305
Enzymes [BR:amaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     amad1_10305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2287830..2289341
Genome map
AA seq 503 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGTIGEIL
NEEGATVLGEQVIAKLEKGGAAAASEPKAKSESKEESKEEAAPAASGKASDVKVPVLPES
VADATIATWHVAVGEAVSRDQNLVDIETDKVVLEVVAPADGSLAEIIAEEGATVTAEEVI
AKFVEGAAGGASAPAASEESDDNDESSDALSPSVRRLLAEKGVDASKVKGTGKNGRITKE
DVEKYLKGGDSAQKSAPASTESAPAELPTGNRTEKRVPMTRLRKTIANRLLEAKNSTAML
TTFNEVNMKPIMDLRKQYQESFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDIV
YHNYFDVSIAVSTPRGLVTPVLKDTDTLGMAGVEKGIKELALKGRDGKLSLAELQGGNFT
ITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGK
ESVGFLVTVKEMLEDPTRLLLDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgagataaaagttccggttctacctgagtcagttgccgatgccaccattgca
acctggcacgttaaggccggtgacgcagttaaacgagaccagaacctggttgatattgaa
actgataaagtggttttagaagttgtggcgccagcggacggtacaattggtgagatccta
aacgaagagggtgcaacagttttaggcgagcaagtaatcgcaaagctagagaagggcggc
gcagctgcagcttctgagccgaaagctaagagtgagtctaaagaagagtctaaagaagaa
gctgctccagcggcttctggcaaagcatctgacgtgaaagtacctgttcttccagaatct
gttgctgatgcaaccattgctacttggcatgttgcggtaggcgaagcggtgtctcgtgac
caaaacttggttgacattgaaactgacaaggtcgtacttgaagtggtagcgcctgcagat
ggttctcttgcagaaatcatcgctgaagaaggcgcaacagtgacagctgaagaagttatt
gccaagtttgttgaaggcgctgcaggcggtgcatcagcaccagcggcttcagaagagagc
gatgacaacgacgaaagcagcgatgcgcttagcccatctgtacgtcgtcttctagctgag
aaaggcgtagatgcgtctaaagttaagggtacgggcaaaaatggccgtatcactaaagaa
gacgttgaaaagtacctaaaaggtggtgacagtgctcaaaaatcagcgcctgcatcaacc
gagtcagcgccagcggaattgccaacgggcaaccgcactgagaagcgtgtacctatgacg
cgtcttcgtaaaacaattgctaatcgtcttcttgaagcgaaaaactcaacagcaatgttg
actacgtttaacgaagtcaacatgaagcctattatggaccttcgtaagcagtatcaagaa
agcttcgagaagcgtcacggtattcgtcttggctttatgtctttctacgtgaaagccgta
actgaagcgcttaagcgttttcctgaagttaacgcgtctatcgacggtgatgatattgtt
tatcacaactatttcgatgtatcgattgctgtttctacaccgcgtggccttgtgacacca
gtacttaaagatactgatacactgggtatggcgggtgttgaaaaaggaattaaggaacta
gcacttaaaggccgtgacggtaagctgtcactcgctgaactacaaggtggtaatttcaca
atcaccaacggtggtgtgtttggttcgctaatgtctacaccaatcattaacccgccacaa
agcgcaattcttggtatgcacaaaatccaagatcgcccaatggcagttaatggcaaagta
gaaattctaccaatgatgtacctagcgctttcttatgaccaccgtattatcgatggtaaa
gaatcggtagggttcttggtaaccgttaaagagatgctagaagatccaacacgtctatta
ctagacgtttaa

DBGET integrated database retrieval system