KEGG   Alteromonas macleodii AltDE1: amad1_11310Help
Entry
amad1_11310       CDS       T02340                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    amad1_11310
Enzymes [BR:amaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     amad1_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2531818..2533572
Genome map
AA seq 584 aa AA seqDB search
MAWEHLHDKVKHHLESIYADVALDVSYETLATELMNTIGIQQQTDIASPQSHHNYWDEED
IIMITYGDSVIDEDERPLVTLNKFMHRYCKNTINNVHILPFFPYSSDDGFSVIDYSTVNE
ALGSWDDIEAIAKDYGLMTDLVINHCSARSVWFDNFVKGEGPGSDFFFTADPADDLSLVT
RPRVSPLLRETETADGTKYVWCTFSHDQVDFDFRNPKVLLAFIDIIKLYIDKGAKIFRLD
AVAFLWKIVGTNSINLFQTHEVIRLIRTLIEHVDPSIIIITETNIPNRENLTYFGNANEA
HAIYNFSLPPLLVNTLVSGDCTYLKSWMMSMPPAQNGTAYFNFIASHDGIGLRPAEGLLS
EEEISDLVHAMQHFGGKVSWRASEHGQQKPYEINITLFDALQGTIKGPDKYQVDRFICAH
AIMLGMEGIPGIYIHSLLGTSNDYEKVANTGQNRSINRKRWDFNELEALLDSPFSQHHKV
LTRISQLIRIRKAQPAFHPNATQFTLQLGNQIFGYWRQSLDRKQSIFCISNICDEEQTIL
LSDINLIGTDNWIDLITRDEISLSSGFLQMKPYQVLWISNQDFE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggagcacctccatgacaaagtaaagcaccatttagaaagcatttacgccgat
gtagcgctagacgtctcttatgagacgctagccacagagctaatgaatacaataggtatt
cagcaacaaacagatatagcttcacctcaatctcatcacaactattgggatgaagaagac
attatcatgatcacctatggtgatagcgtgattgatgaagatgagcgccctcttgttacg
ttgaataagttcatgcatcgttattgtaagaacacaatcaataacgtgcatattcttccc
ttctttccttatagttccgatgacggtttttctgtcatcgactactctacggtaaacgaa
gcattagggtcgtgggatgatatcgaagctatagccaaagattatggcttgatgacagac
ttagtgataaaccactgctctgcgcggagcgtttggttcgacaactttgttaaaggtgaa
gggccgggatctgactttttctttaccgcagatccggctgacgatttatcgctggtgacc
cgccctcgtgtttcccctttattgcgtgaaaccgagaccgccgatggcactaagtatgtg
tggtgtaccttcagtcacgatcaagtagactttgactttagaaaccccaaagtgctttta
gcgtttatcgatatcattaaactgtacattgataaaggcgccaagatattccgtttagac
gcggttgcctttctatggaaaattgtgggcacaaacagcattaatctgtttcaaactcac
gaagtcattcgtttaataagaaccctgattgaacacgttgacccatccatcattatcatt
accgaaacaaatattccaaacagggaaaatctaacctattttggtaatgcaaatgaagcc
catgcaatctataacttttcgttaccgccactgcttgtaaacacattggtaagtggtgat
tgtacttatttgaagagttggatgatgagcatgcctcctgcacaaaacggcacggcatac
tttaactttattgcttcgcacgatggtattgggctgcgccctgcagaaggcctgctttct
gaagaagaaatatctgatttggttcacgccatgcagcacttcggtggaaaagtatcttgg
cgggcctctgagcatggtcagcaaaaaccgtatgaaattaacatcacactgtttgacgct
ctgcaaggcacgataaaggggcctgacaagtatcaggtcgaccgttttatttgtgcacat
gccattatgttaggcatggaaggtattcctggtatctatattcatagtttactgggcacc
tctaacgactatgagaaagtcgctaacactggccagaaccgctcgataaacagaaagcgc
tgggactttaacgagctagaagccttgttagattctcctttctctcagcatcacaaggtt
ttaactcgtatatctcagttaatccgcatacgtaaagctcagcctgcattccaccctaat
gctacgcagtttacgctgcaattgggcaatcaaatattcggctattggcgtcagagctta
gacagaaagcaaagtattttctgtatcagcaatatttgtgacgaagagcaaactattttg
ctttctgacattaacttgataggtacagacaactggattgacctcattacccgtgatgag
atttcactttccagcggctttttacaaatgaagccctaccaagtactgtggatcagtaac
caagattttgaataa

DBGET integrated database retrieval system