KEGG   Alteromonas mediterranea DE1: amad1_12145Help
Entry
amad1_12145       CDS       T02340                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00010  Glycolysis / Gluconeogenesis
amaa01100  Metabolic pathways
amaa01110  Biosynthesis of secondary metabolites
amaa01120  Microbial metabolism in diverse environments
amaa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amad1_12145
Enzymes [BR:amaa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     amad1_12145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Peptidase_C47
Motif
Other DBs
NCBI-ProteinID: AFV85934
Position
2719370..2720221
Genome map
AA seq 283 aa AA seqDB search
MPPVSSVTVSESNGLTFLDVDNALATARISLFGGHILSYVPKSDDKERLWVSPHAYLNGE
RPIRGGIPVCWPWFSDDHGREKGALPSHGFLRTQVWKLIDSKDDDSGTTIELSPSFTRAD
GFENECNVSMVIKVGNTMDISLITENTGVAPFEFNCALHTYFHVDHIQHTLISGIEGQYK
DKLDNWALKATPTPYAITGETDRIHLAPIKTADIEVDGNAFTQVVSEGNDSLVVWNPWQS
AASISDMDPFGYKHMLCVETSLTQGKTLAPSECHTLKQTIVPR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgttagttcagtcactgttagcgagtctaatggacttacctttttagatgtc
gataacgcattagccacggcgcgaataagcctgtttggcggccatatcttgtcttatgta
cctaaaagcgatgataaagaacgcctttgggtcagccctcacgcctatttaaacggagag
cggccaattcgcggcggtattcccgtttgctggccgtggttcagtgacgaccacgggcgg
gaaaaaggtgcccttccctcccatggctttttaagaacccaagtgtggaagttgattgat
tcaaaagacgacgatagcggcacaaccatcgaattgtcaccaagctttacacgggcagat
ggctttgaaaatgagtgtaacgtgtccatggtgatcaaggtgggcaatacaatggacatc
tctttaattactgaaaataccggcgtggcacctttcgaatttaactgtgcgcttcacact
tatttccatgttgaccatattcaacatacgctaattagtggtattgaaggccagtacaaa
gataaactggataactgggcgttaaaagcaacacccaccccttacgccattaccggtgaa
actgaccgcattcacttagcgccaatcaaaacggccgacattgaagtggacggtaatgct
tttactcaagtcgtttctgagggtaatgactcacttgtagtatggaacccatggcaaagt
gccgcctctatttcagacatggacccgtttggttacaagcatatgctgtgcgtagagaca
tcattaacgcaagggaaaacgttagcacctagcgagtgccacacgctgaaacaaactatc
gttccacgataa

DBGET integrated database retrieval system