KEGG   Alteromonas macleodii AltDE1: amad1_12155Help
Entry
amad1_12155       CDS       T02340                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amad1_12155
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amad1_12155
   00052 Galactose metabolism
    amad1_12155
   00500 Starch and sucrose metabolism
    amad1_12155
   00520 Amino sugar and nucleotide sugar metabolism
    amad1_12155
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    amad1_12155
   00524 Butirosin and neomycin biosynthesis
    amad1_12155
Enzymes [BR:amaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     amad1_12155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2721014..2721967)
Genome map
AA seq 317 aa AA seqDB search
MSQKFVADVGGTNIRVARVTESGVADIKKYMCNDFASIDLAIAQYFSDMPEYSFSQGCIA
IACPVLGDQVEMTNHSWAFSQNALRSQLKLDALFVINDFTAVAHSLPVLGEEQVVQIGEG
TAKENGNIAVFGPGTGLGVEHITMTSTGWQTLDGEGGHVDFAPVDETDVVVWRHLQSTLG
RASAEEVMSGRGLHNIYTALANHASAPVVFTEPAQITDAALNGTCKIAEATLTQFCRIMG
SFAGNLALNMATTGGIFIGGGIANRFPEFIQNSDFRARFEAKGQMKHYVKDIPTYLIAEP
DHGLLGAAAYLNQNTAS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaagtttgtggctgatgttggcggtacgaatattcgcgttgcaagggtaacc
gaatcaggtgtggccgacatcaagaaatacatgtgtaatgattttgccagcattgacctt
gctattgcacaatactttagcgacatgccggaatacagcttttcgcagggctgtattgct
attgcatgtccagtattgggcgatcaagtcgagatgacgaatcacagctgggcattttcg
caaaatgcgcttcgctcgcagcttaaactagatgcgttgttcgttattaacgacttcact
gccgtagcgcactcattgcctgtattaggcgaagagcaagtggtgcaaattggtgaaggc
acagcgaaagaaaatggcaacatcgctgtttttgggccaggtacgggattaggtgttgaa
catatcacgatgacctcaaccggttggcagacgctagacggagaaggtggtcacgtagac
tttgcaccggtagatgaaaccgatgttgtcgtatggcgtcaccttcaatctaccttagga
cgtgcttctgctgaagaagtaatgtctggacgcggcctgcataatatttacaccgcgcta
gcaaaccacgcatcagcaccagttgtatttaccgagccggctcaaatcactgacgctgcg
ctgaacggtacctgtaaaattgctgaagcgacgcttacccaattctgccgaattatggga
agctttgcgggtaatttagcacttaacatggcaaccacgggcggcatcttcattggtggt
ggcattgctaaccgtttccctgaatttattcaaaatagcgattttagagcgcgttttgaa
gcgaaagggcaaatgaagcactacgtgaaagacattcccacctatttaattgcagaacct
gatcatggtttattgggtgcggctgcatatctgaatcaaaatacagcgagctaa

DBGET integrated database retrieval system