KEGG   Alteromonas macleodii AltDE1: amad1_12575Help
Entry
amad1_12575       CDS       T02340                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amaa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2821909..2823405
Genome map
AA seq 498 aa AA seqDB search
MSIRNGVQLITYADRLGDGNIESLTNLLDGPLKGLFKGVHILPFYYPYDGEDAGFDPIDH
TTVDERLGDWNNIKKLGESVDIMADLIVNHMSGQSEAFTDVLKKGRESEYWPLFLTKEDV
FSGNDQAEIDEQIAKVFRPRPTPFFSDYEVGTETDSTETVPFWTTFTSNQIDIDVESELG
KEYLSSILQSFTESNVDLIRLDAAGYAIKRAGSNCFMLEETFEFIEALSKRARTMGMQCL
VEIHSHYQTQIDIAARCDSVYDFALPPLVLHTLFTKDASALAHWLSISPRNCFTVLDTHD
GIGIVDVSASGDKPGLINADAINALVEQIHVNSNGVSKKATGAAANNVDLYQVNCTYYDA
LGKDDFAYLVARAIQFFSPGIPQVYYGGLLAAHNDMELLANTNVGRDINRPYLTTAMVED
AIQKPVVKGLMQLITLRNENKAFGGAFDVTYTDNTLVLSWSNDGDAASLTVDFAAMDATI
NTVSNGEESTLSIGALLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctatacgcaatggcgttcagttaattacatatgcggaccgactaggcgacggcaac
atcgaaagtctaaccaatctactggatggcccccttaaaggcttgtttaaaggtgttcat
attttacctttttactacccttacgacggagaagatgcagggtttgaccccatcgatcac
accacagtagacgaacgtctaggcgattggaacaatattaaaaagcttggtgagtcggta
gatattatggccgacctcattgtgaaccatatgtcaggtcaaagcgaagcatttacagat
gtgcttaagaagggacgagagtctgaatactggccactattccttacaaaagaagatgtt
ttctctggcaacgatcaggctgaaattgacgaacagatcgcaaaagtcttccgccctcgc
cctacgccatttttcagcgactacgaagttggtacagagacagactcgacggaaacggta
ccattttggacaacatttacatcgaatcaaattgatattgacgttgagtcggagttaggg
aaagagtacctttcttctatccttcagtcgtttaccgaaagtaacgttgatctgatacgt
ttagatgcagccggttacgctattaaacgcgcaggttcaaattgcttcatgcttgaagag
acatttgaatttattgaagccctttctaagcgagctcgcaccatgggcatgcaatgtctg
gttgaaattcacagccattaccaaacgcaaattgatatcgcggcacgttgtgacagcgtt
tatgacttcgcactaccacctttggtgctgcacactctattcaccaaagatgcgagcgca
ctagcgcattggttgtctatttctcctcgcaactgctttacagtactcgatacgcacgac
ggtatcggtattgttgatgtgagtgcaagcggcgacaaaccaggcctgattaacgccgac
gctatcaacgcattagttgaacaaattcacgttaattcaaatggcgtgtctaaaaaggca
accggcgcggcagccaacaacgttgacctttatcaggtcaactgtacctactatgacgcg
ctaggcaaagacgactttgcttacttagtagcgagagctatccaattcttcagcccaggt
attcctcaagtttattacggtggcttacttgctgcgcacaacgacatggagctactagca
aacacgaatgtgggtcgcgatataaaccgcccttatttaacaacagcgatggttgaagac
gctattcaaaagccagttgttaaaggtttaatgcagcttattacgcttagaaacgaaaac
aaagcgtttggcggcgcttttgacgttacgtatacggataacactcttgtactgtcgtgg
agcaacgacggtgatgcagcatcattaaccgtagatttcgctgcaatggacgcgactatt
aacacggttagcaatggcgaagaaagcacgctttctataggcgctctattagcctaa

DBGET integrated database retrieval system