KEGG   Alteromonas macleodii AltDE1: amad1_13150Help
Entry
amad1_13150       CDS       T02340                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    amad1_13150
DNA repair and recombination proteins [BR:amaa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      amad1_13150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2951299..2951898)
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLSELIQALTCLPGVGNKSAQRMAFHLLERNRTGAIDLSNVLHNAMEHIHHCKRC
RTFTEDELCEICRHPEREASGLLCIVESPQDVLAIEQTLSYKGQYFVLMGHLSPIDGVGP
EEIGLTELEGRLSAGGINEVILATNPTVEGEATAHYIAQLCASHNVDASRIAHGVPVGGE
LEYIDGNTLTHAFSGRRKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagcccgttactatcagaattaatccaggcactaacctgcctccctggcgtt
gggaataaaagcgcccagagaatggcgttccaccttttggaacgaaaccgtacaggtgct
atcgacctcagtaacgttttgcacaatgccatggagcacatacatcactgtaagcgctgt
agaacgtttaccgaagatgagctttgcgaaatatgccgtcacccagagagagaggctagt
ggcttattgtgtatcgtggaaagccctcaagatgtgttagctatcgagcaaacgttgagc
tacaaaggccagtatttcgtgctgatggggcatctatcgcctatcgatggcgtggggcct
gaagaaataggattaactgaacttgaagggcgccttagcgcgggtggcattaacgaggtc
attcttgctacaaacccaacggttgagggagaagccacggcgcattatattgcccagttg
tgcgccagtcacaacgtggatgcctctcgtatagcccacggtgtgcctgttgggggggag
ttagagtatatcgatggcaacacccttactcatgcattttcaggccgtcgcaaattataa

DBGET integrated database retrieval system